Primary Antibodies

<p>CXCR4 antibody was raised in goat using YSEEVGSGDYDSNKEPCFRDENVHFNR corresponding to the N-terminal extracellular domain of mouse CXCR4 receptor.   as the immunogen.</p>

<p>RFESD antibody was raised using a synthetic peptide corresponding to a region with amino acids VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK</p>

<p>Rabbit polyclonal NFKP p105/p50 antibody (Ser932)</p>

<p>Rabbit Polyclonal Abl1 antibody (Tyr204)</p>

<p>Rabbit polyclonal Chicken Serum Albumin antibody (biotin)</p>

<p>Aquaporin 5 antibody is a polyclonal antibody that specifically targets the Aquaporin 5 protein. Aquaporins are a family of integral membrane proteins that facilitate the transport of water across cell membranes. Aquaporin 5 is primarily found in the salivary glands, lungs, and lacrimal glands, where it plays a crucial role in regulating fluid secretion.</p>

<p>The ARNT2 antibody is a highly specialized antibody that is used in various assays and research studies in the field of Life Sciences. This antibody specifically targets and binds to ARNT2, which is a protein involved in various cellular processes. The ARNT2 antibody can be used for applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>The MEK1 antibody is a powerful tool used in various scientific and medical research applications. This antibody specifically targets the MEK1 protein, which plays a crucial role in cell signaling pathways. By binding to the MEK1 protein, this antibody can effectively block its activity and provide valuable insights into cellular processes.</p>

<p>Rabbit polyclonal RPS9 antibody (HRP)</p>

<p>Purified Polyclonal CDYL2 antibody</p>

<p>The PAK4 antibody is a protein that specifically targets and neutralizes the activity of PAK4. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. PAK4 is an important enzyme involved in various cellular processes, including cell migration, proliferation, and survival. The PAK4 antibody can be used in experiments to study the role of PAK4 in these processes. It can also be used as a diagnostic tool to detect the presence of autoantibodies against PAK4 in certain diseases. Additionally, monoclonal antibodies targeting PAK4 have been developed and can be used as therapeutic agents to inhibit its activity. The PAK4 antibody is available as both polyclonal and monoclonal forms, and it has been extensively validated for its specificity and efficacy.</p>

<p>The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.</p>

<p>Purified Rabbit polyclonal OR51F2 antibody</p>

<p>DPYSL3 antibody was raised in Rabbit using Human DPYSL3 as the immunogen</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a central role in various cellular processes. It's a key player in the PI3K/Akt/mTOR pathway, which is essential for regulating cell growth, survival, metabolism, and proliferation.Structure: Akt has three main isoforms in humans (Akt1, Akt2, and Akt3), each encoded by different genes. Activation: Akt activation is typically initiated by external signals, such as growth factors or insulin, that bind to cell surface receptors. This activates phosphoinositide 3-kinase (PI3K), which then produces phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane. PIP3 then recruits Akt to the membrane where it is activated by two key phosphorylation events at Thr308 and Ser473. Once fully activated, Akt can move to different parts of the cell to phosphorylate its target proteins.The key functions of Akt include:Cell Survival and Anti-Apoptosis: Akt inhibits apoptosis by phosphorylating and inactivating several pro-apoptotic proteins, such as BAD and Caspase-9.Cell Growth and Proliferation: By promoting protein synthesis and inhibiting pathways that would otherwise halt the cell cycle, Akt encourages cell growth. It activates mTOR, a major regulator of protein synthesis and cellular growth.Metabolic Regulation: Akt influences metabolism by increasing glucose uptake and glycolysis, primarily through GLUT4 translocation and hexokinase activation, which is especially important in muscle and adipose tissues.Angiogenesis: Akt can stimulate the growth of new blood vessels by increasing the expression of VEGF (vascular endothelial growth factor), supporting tissue growth and repair.Cell Migration and Invasion: Akt is involved in processes that facilitate cell motility, aiding in wound healing and, unfortunately, in the spread of cancer cells.Given its role in promoting cell survival and growth, Akt is frequently hyperactivated in cancers, leading to uncontrolled cell division and tumor growth. Many cancer therapies target the PI3K/Akt/mTOR pathway to suppress this hyperactivity. Furthermore Akt's role in regulating glucose metabolism links it to insulin signaling. Defects in this pathway can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.</p>

<p>The ZFP36L1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the ZFP36L1 protein, which plays a crucial role in regulating gene expression. This antibody has been extensively tested and validated for its specificity and reliability.</p>

<p>Purified Rabbit polyclonal OSGEPL1 antibody</p>

<p>The FOXO4 antibody is a monoclonal antibody that specifically targets the protease FOXO4. This protease plays a crucial role in extracellular processes and has been implicated in various diseases. The FOXO4 antibody binds to the protease, inhibiting its activity and preventing it from carrying out its normal functions.</p>

<p>HMBS antibody was raised using the middle region of HMBS corresponding to a region with amino acids SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR</p>

<p>AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE</p>

<p>DHX38 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 38 (Dhx38)</p>

<p>FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL</p>

<p>Rabbit polyclonal CENPA antibody</p>

<p>The PCNA antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets proliferating cell nuclear antigen (PCNA), which plays a crucial role in DNA replication and repair. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal PP1 alpha antibody</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>