Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,764 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SLC22A7 antibody
<p>SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE</p>Purity:Min. 95%PDE7B antibody
<p>PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%HSP27 antibody
<p>The HSP27 antibody is a highly specialized tool used in Life Sciences research. It is designed to target and bind to the Heat Shock Protein 27 (HSP27), a protein involved in cellular stress response and regulation. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA).</p>Purity:Min. 95%ATP6AP1 antibody
<p>The ATP6AP1 antibody is a highly specialized antibody that targets the ATP6AP1 protein. This protein is involved in various biological processes, including dopamine synthesis and secretion. The ATP6AP1 antibody has been extensively studied and found to be an effective tool for research purposes.</p>INSL5 antibody
<p>INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK</p>SRBD1 antibody
<p>SRBD1 antibody was raised using the N terminal of SRBD1 corresponding to a region with amino acids MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS</p>LIG1 antibody
<p>LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR</p>Purity:Min. 95%DDX28 antibody
<p>DDX28 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS</p>GPD1L antibody
<p>GPD1L antibody was raised using the middle region of GPD1L corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV</p>RPS6KB1 antibody
<p>RPS6KB1 antibody was raised using the N terminal of RPS6KB1 corresponding to a region with amino acids KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF</p>Rabbit anti Rat IgG (H + L)
<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>Purity:Min. 95%CCDC16 antibody
<p>CCDC16 antibody was raised in rabbit using the middle region of CCDC16 as the immunogen</p>Purity:Min. 95%FCN3 antibody
<p>FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL</p>Purity:Min. 95%VGF antibody
<p>VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM</p>Purity:Min. 95%Gnpda1 antibody
<p>Gnpda1 antibody was raised in rabbit using the N terminal of Gnpda1 as the immunogen</p>Purity:Min. 95%SEMA4F antibody
<p>SEMA4F antibody was raised using the N terminal of SEMA4F corresponding to a region with amino acids PLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVPHTYNYSVLLV</p>Purity:Min. 95%SMC1A antibody
<p>SMC1A antibody was raised in rabbit using the C terminal of SMC1A as the immunogen</p>Purity:Min. 95%Tetracycline antibody
<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>Purity:≥90%
