Primary Antibodies

<p>Rabbit polyclonal PLAU antibody (FITC)</p>

<p>The SNX1 antibody is a monoclonal antibody that specifically targets erythropoietin (EPO). It is widely used in the field of Life Sciences for research purposes. This antibody has the ability to bind to EPO and its receptor, inhibiting their interaction and blocking downstream signaling pathways. The SNX1 antibody can also be used to detect the presence of autoantibodies against EPO in human serum samples. Additionally, it can be utilized in immunoassays to measure EPO levels or to study the binding properties of EPO binding proteins. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying erythropoiesis, growth factors, and related processes.</p>

<p>Purified Polyclonal GSK3 alpha/beta antibody</p>

<p>The ATF2 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Monoclonal Antibodies and is widely used for various applications. This antibody specifically targets ATF2, a transcription factor that plays a crucial role in regulating gene expression.</p>

<p>Rabbit anti-sheep IgG (biotin) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.</p>

<p>The Paxillin antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes paxillin, a protein involved in cell adhesion and migration. This antibody has been widely used in research to study various cellular processes, including growth factor signaling, chemokine-induced migration, lipoprotein lipase activity, TGF-beta signaling, and more. The Paxillin antibody has also shown cytotoxic effects on activated cells and has been used as a therapeutic agent in certain diseases. With its ability to specifically bind to paxillin and inhibit its function, this antibody has become an essential tool for scientists studying cell biology and related fields.</p>

<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI</p>

<p>Rabbit polyclonal RPL17 antibody</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>Rabbit polyclonal TRAP1 antibody</p>

<p>LUC7L antibody was raised in rabbit using the middle region of LUC7L as the immunogen</p>

<p>IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL</p>

<p>The DOCK11 antibody is a growth factor that plays a crucial role in various processes within the Life Sciences field. It is an essential component in cell antigen recognition and the production of antibodies. The DOCK11 antibody has been shown to inhibit the activity of protons, which are responsible for acidification and cellular damage. Additionally, it has been found to have inhibitory effects on interleukin-6, a cytokine involved in inflammation and immune response regulation.</p>

<p>INSR antibody was raised in Rabbit using Human INSR as the immunogen</p>

<p>BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.</p>

<p>The CPA1 antibody is a monoclonal antibody that specifically targets the CPA1 enzyme. This antibody has been extensively studied for its protease activity and its potential applications in the field of life sciences. It has been shown to effectively inhibit the activity of CPA1, which plays a crucial role in various physiological processes.</p>

<p>Rabbit polyclonal ELOVL3 antibody</p>

<p>BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR</p>

<p>PON1 antibody was raised using the middle region of PON1 corresponding to a region with amino acids VVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF</p>

<p>The LYN antibody is a highly specialized monoclonal antibody used in Life Sciences. It has neutralizing properties and is particularly effective against antiphospholipid antibodies found in human serum. This antibody specifically targets the 5-ht7 receptor, which plays a crucial role in various physiological processes.</p>

<p>ISL2 antibody was raised in mouse using recombinant Human Isl Lim Homeobox 2</p>

<p>Rabbit polyclonal Tuberin antibody (Thr1462)</p>

<p>SNIP1 antibody was raised in rabbit using the middle region of SNIP1 as the immunogen</p>

<p>The FKBPL antibody is a high-quality polyclonal antibody that is colloidal in nature. It specifically targets the thioredoxin interacting protein (FKBPL) and forms a strong disulfide bond with it. This antibody is widely used in life sciences research for various applications, including the study of reactive growth factors and biomolecules. It can also be used as a drug antibody or diagnostic reagent due to its high specificity and affinity for FKBPL. Additionally, this antibody has shown promising results in collagen-related research and can be used in electrode-based assays. For researchers looking for a reliable monoclonal antibody, the FKBPL antibody is an excellent choice. Its effectiveness against TGF-beta makes it an essential tool for studying this important signaling pathway.</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>