Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Mouse Serum Albumin antibody
Mouse serum albumin antibody was raised in rabbit using mouse serum as the immunogen.Purity:Min. 95%EphB1 antibody
EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.
PYCR2 antibody
PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
SOCS3 antibody
The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.WTAP antibody
The WTAP antibody is a powerful tool in life sciences research. It is an antibody that specifically targets the WTAP protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity.
IRX6 antibody
IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen
Purity:Min. 95%alpha Actinin 1 antibody
alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
Synaptotagmin antibody
The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.
Donkey anti Rat IgG (H + L) (Fab'2) (PE)
Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.
Purity:Min. 95%PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
CKMM antibody
CKMM antibody was raised in mouse using CKMM purified from human smooth muscle as the immunogen.NSUN4 antibody
NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP
KIF5B antibody
KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE
Purity:Min. 95%PSA antibody
The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.
CDK2 antibody
The CDK2 antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been found to be effective in inhibiting the growth of hepatocyte, promoting natriuretic activity, and regulating fibrinogen activation. The CDK2 antibody is also known for its histidine glycosylation properties, which enhance its stability and binding affinity. Additionally, this antibody has been used in the detection and quantification of autoantibodies and steroids. With its high specificity and reliability, the CDK2 antibody is a valuable tool for researchers in need of accurate and precise measurements in their studies.
GLP1 antibody
The GLP1 antibody is a monoclonal antibody that acts as an immunosuppressant. It targets specific molecules such as alpha-fetoprotein, calmodulin, and angptl3, inhibiting their activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the effects of these molecules. Additionally, it has been found to have an inhibitory effect on phosphatase activity. The GLP1 antibody can be used in various applications, including research studies and therapeutic interventions. Its unique properties make it a valuable tool for investigating adipose tissue biology, colloidal chemistry, chemokine signaling pathways, and human serum analysis. With its high specificity and efficacy, this antibody is an essential component for any laboratory or research facility looking to advance their understanding of these biological processes.Chicken anti Goat IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.
Purity:Min. 95%Moesin antibody
Moesin antibody is an endogenous hematopoietic monoclonal antibody that has anticoagulant properties. It binds to fatty acids and other molecules, inhibiting their activity in the blood. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help prevent the formation of new blood vessels and inhibit tumor growth. Moesin antibody is activated at acidic pH levels and can effectively neutralize insulin antibodies in human serum. Additionally, this antibody has been used as a growth factor in cell culture experiments due to its ability to promote cell proliferation and survival.AIFM3 antibody
AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
CD100 antibody
The CD100 antibody is a monoclonal antibody that targets the erythropoietin receptor. It has been widely used in the field of Life Sciences for various applications. This antibody specifically binds to the erythropoietin receptor, which plays a crucial role in red blood cell production and differentiation. By targeting this receptor, the CD100 antibody can modulate erythropoiesis and potentially have therapeutic effects on conditions related to red blood cell disorders.
LZTFL1 antibody
LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Plakophilin 2 antibody
Plakophilin 2 antibody was raised in Guinea Pig using human synthetic plakophilin 2 as the immunogen.Purity:Min. 95%A2M antibody
The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.
Purity:Min. 95%COL11A1 antibody
The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.
ASB6 antibody
ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVPurity:Min. 95%
