Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
RARA antibody
The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.
PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
Donkey anti Rat IgG (H + L) (Fab'2) (PE)
Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.
Purity:Min. 95%GPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%PSMD4 antibody
The PSMD4 antibody is a neutralizing monoclonal antibody that targets antiphospholipid antibodies. It is used as a test substance in various research applications, including in vitro and in vivo studies. This antibody specifically binds to the PSMD4 protein, which is an essential component of the 26S proteasome. The PSMD4 antibody has been shown to effectively neutralize the activity of autoantibodies, preventing their harmful effects on cells and tissues. It can be used in immunoassays to detect the presence of PSMD4 or as a tool for studying its function and interactions with other molecules. With its high specificity and affinity for PSMD4, this monoclonal antibody is a valuable resource for researchers in the field of Life Sciences.
Plakophilin 2 antibody
Plakophilin 2 antibody was raised in Guinea Pig using human synthetic plakophilin 2 as the immunogen.Purity:Min. 95%PDIA4 antibody
PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL
Purity:Min. 95%ABHD7 antibody
ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY
Purity:Min. 95%PD1 antibody
PD1 antibody is a protein that belongs to the family of antibodies. It plays a crucial role in regulating the immune response and preventing autoimmune diseases. PD1 antibody binds to the programmed cell death protein 1 (PD-1), which is expressed on the surface of T cells, B cells, and other immune cells. By binding to PD-1, this antibody blocks its interaction with programmed death-ligand 1 (PD-L1) and programmed death-ligand 2 (PD-L2), inhibiting the inhibitory signals that suppress T cell activation.
Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(c) fragment as the immunogen.
Purity:Min. 95%STC2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Trazodone antibody
The Trazodone antibody is a reactive monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α) and interleukin (IL), which are key inflammatory factors in the body. This antibody has shown inhibitory effects on adipose tissue and chemokine production, making it a potential therapeutic option for conditions associated with inflammation and immune dysregulation. Additionally, the Trazodone antibody has been found to have neutralizing activity against Brucella abortus, a bacterium that causes brucellosis in animals and humans. This suggests its potential use in treating infections caused by this pathogen. Furthermore, this antibody exhibits inhibitory effects on family kinase inhibitors and calmodulin, which are involved in various cellular processes such as signal transduction and calcium signaling. By targeting these proteins, the Trazodone antibody may have implications for the treatment of diseases related to their dysPurity:Min. 95%MYST1 antibody
MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.
Goat anti Human kappa chain (HRP)
This antibody reacts with kappa light chains on human immunoglobulins.Purity:Min. 95%TBCB antibody
TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Sheep anti Rabbit IgG (H + L) (Alk Phos)
Sheep anti-rabbit IgG (H+L) (Alk Phos) was raised in sheep using rabbit IgG whole molecule as the immunogen.Purity:Min. 95%GLUT4 antibody
The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.
Purity:Min. 95%Prothrombin factor II antibody (HRP)
Prothrombin factor II antibody (HRP) was raised in sheep using human Prothrombin purified from plasma as the immunogen.SITPEC antibody
SITPEC antibody was raised in rabbit using the middle region of SITPEC as the immunogen
Purity:Min. 95%GOT1 antibody
GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Chlamydia trachomatis antibody (HRP)
Chlamydia trachomatis antibody (HRP) was raised in rabbit using L2 and other serovar groups as the immunogen.
SRY antibody
The SRY antibody is a highly specialized growth factor that has been extensively studied in the field of Life Sciences. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and development. The SRY antibody has been shown to have a neutralizing effect on interferon-gamma (IFN-gamma), which is an important cytokine involved in immune responses.HHIPL1 antibody
HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen
Purity:Min. 95%HRB antibody
HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN
STAT3 antibody
The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
Purity:Min. 95%FBXO24 antibody
FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids QTLQDRTEKMKEIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPE
RNF19A antibody
RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Purity:Min. 95%
