Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
SCAP antibody
The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.
Fibrinopeptide A antibody
Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.
A2M antibody
The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.
Purity:Min. 95%PDIA4 antibody
The PDIA4 antibody is a highly specialized product in the field of Life Sciences. It possesses unique characteristics that make it a valuable tool for various applications. This monoclonal antibody has been developed to target and neutralize the activity of PDIA4, a protein kinase involved in important cellular processes.
GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Purity:Min. 95%MPP5 antibody
MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
NKAIN1 antibody
NKAIN1 antibody was raised using the middle region of NKAIN1 corresponding to a region with amino acids TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVPurity:Min. 95%BP1 antibody
The BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to BP1, a protein that is found in human serum. The binding of the BP1 antibody to its target protein can be used for various applications, including research and diagnostic purposes.
GTPBP2 antibody
GTPBP2 antibody was raised using the C terminal of GTPBP2 corresponding to a region with amino acids VLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFL
ABHD7 antibody
ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY
Purity:Min. 95%HIPK2 antibody
The HIPK2 antibody is a highly specialized tool used in Life Sciences research. It is a Polyclonal Antibody that is designed for the ultrasensitive detection and neutralization of clostridial neurotoxins. The antibody can be immobilized on a carbon electrode, allowing for electrochemical impedance spectroscopy to be performed. This technique enables researchers to accurately measure the presence and activity of the toxins in various samples.
PBLD antibody
The PBLD antibody is a highly specific monoclonal antibody that targets the chemokine receptor PBLD. It plays a crucial role in the regulation of various immune responses, including the activation and migration of immune cells. The PBLD antibody has been extensively studied for its potential therapeutic applications in cancer immunotherapy and autoimmune diseases.
MMP7 antibody
The MMP7 antibody is a highly specific monoclonal antibody that targets the matrix metalloproteinase 7 (MMP7) enzyme. MMP7 plays a crucial role in various biological processes, including tissue remodeling, wound healing, and cell proliferation. This antibody is widely used in Life Sciences research to study the function and regulation of MMP7.
Parathyroid Hormone antibody
The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.
STK17A antibody
STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)
Streptococcus Group A antibody (FITC)
Streptococcus group A antibody (FITC) was raised in rabbit using group A Streptococci as the immunogen.Rabbit anti Human IgG (Texas Red)
Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%HSV2 gC antibody
HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.
PYCR2 antibody
PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
RHPN1 antibody
RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
CD69 antibody (biotin)
CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.
Purity:Min. 95%PRMT5 antibody
The PRMT5 antibody is a highly effective inhibitor that specifically targets protein kinase activity. This monoclonal antibody has been extensively tested and validated by Life Sciences experts to ensure its efficacy. It can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.
Plakophilin 2 antibody
Plakophilin 2 antibody was raised in Guinea Pig using human synthetic plakophilin 2 as the immunogen.Purity:Min. 95%SET antibody
SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity:Min. 95%RPESP antibody
RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Mouse Thrombocyte antibody (FITC)
Mouse thrombocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymocytes as the immunogen.
