Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
alpha Synuclein antibody
The alpha Synuclein antibody is a valuable tool in Life Sciences research. This antibody specifically targets and inhibits the activity of alpha-synuclein, a protein that plays a crucial role in neurodegenerative diseases such as Parkinson's disease. The antibody has been extensively tested and validated for its efficacy in human serum samples. It effectively neutralizes the activated form of alpha-synuclein, preventing its interaction with other proteins and mitigating its toxic effects on neurons.Purity:Min. 95%CD90.2 antibody (Spectral Red)
CD90.2 antibody (Spectral Red) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.
Purity:Min. 95%Salmonella antibody (FITC)
Salmonella antibody (FITC) was raised in rabbit using a mixture of S. enteriditis, S. typhimurium and S. heidelburg as the immunogen.CSNK1G1 antibody
CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen
Purity:Min. 95%Gja4 antibody
Gja4 antibody was raised in rabbit using the N terminal of GJA4 as the immunogenPurity:Min. 95%LIMK1 antibody
The LIMK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the LIMK1 protein, which plays a crucial role in cellular processes such as cell migration and cytoskeletal organization. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.
TIE1 antibody
The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.
HAX1 antibody
The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.
P2RX2 antibody
P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG
CA 50 antibody
CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.
Purity:Min. 95%Goat anti Rabbit IgG (Alk Phos)
Goat anti-rabbit IgG (Alk Phos) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Purity:Min. 95%GSK3beta antibody
GSK3beta antibody was raised in mouse using recombinant human GSk3 beta (341-420aa) purified from E. coli as the immunogen.
LTBR antibody
The LTBR antibody is a highly effective tool in the field of Life Sciences. It specifically targets and inhibits the activity of glycoproteins involved in various cellular processes. This polyclonal antibody has been extensively studied and shown to have potent cytotoxic effects on activated cells. Additionally, it has been found to interfere with the p38 mitogen-activated protein kinase (MAPK) pathway, a key signaling pathway involved in cell proliferation and survival.
CD19 antibody (PE-CY7)
CD19 antibody (PE) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.
Purity:Min. 95%PPAR alpha antibody
PPAR Alpha antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) V D T E S P I C P L S P L E A D D(18) C of mouse PPAR alpha.Purity:Min. 95%PGP9.5 antibody
PGP9.5 antibody was raised in mouse using recombinant human PGP9.5 (1-223aa) purified from E. coli as the immunogen.Aggrecan antibody
The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.
Goat anti Rat IgG (Fab'2) (FITC)
Goat anti-rat IgG (Fab'2) (FITC) was raised in goat using rat IgG F(c) fragment as the immunogen.
Purity:Min. 95%
