Primary Antibodies

Affinity purified Rabbit polyclonal Beta ETF antibody

DENND1A antibody was raised using the N terminal of DENND1A corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

The IL4 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying various aspects of immunology and molecular biology. This antibody specifically targets interleukin-4 (IL-4), a cytokine involved in immune responses and inflammation.

CD40 antibody is a monoclonal antibody used in Life Sciences for various applications. It specifically targets CD40, a cell surface receptor involved in immune responses. This antibody can activate human endothelial cells and has been shown to have antiangiogenic properties, reducing microvessel density. CD40 antibody can be used in combination with other therapies for antiangiogenic therapy. Additionally, it has been used in DNA vaccine studies to enhance the immune response by targeting antigenic peptides. CD40 antibody has also been found to inhibit the production of tumor necrosis factor-alpha (TNF-α), which plays a role in inflammation and immune response regulation.

GBA3 antibody was raised in Rabbit using Human GBA3 as the immunogen

Affinity purified Rabbit polyclonal alpha SNAP antibody

The Keratin 19 antibody is a highly specialized monoclonal antibody that targets the growth factor Keratin 19. It is commonly used in Life Sciences research for various applications such as hybridization studies, high-affinity glucose binding assays, and polymerase chain reactions (PCR). This antibody can also be utilized in the development of polymeric micelles for drug delivery systems and as a tool in gene therapy using adeno-associated virus vectors. Additionally, the Keratin 19 antibody has been shown to play a role in preventing deprivation-induced apoptosis by targeting molecular pathways involved in cell survival. Its specificity towards Keratin 19 makes it an ideal tool for studying sugar transport mechanisms, collagen synthesis, and the effects of compounds like okadaic acid on cellular processes. With its exceptional affinity and versatility, the Keratin 19 antibody is an invaluable asset for researchers exploring a wide range of molecular targets in their scientific investigations.

Granzyme A antibody is a monoclonal antibody that specifically targets and binds to granzyme A, a serine protease enzyme involved in immune response and cell death. This antibody can be used for various applications in the field of Life Sciences, including research on immune system function, cancer therapy, and autoimmune diseases. It has been shown to inhibit the activity of granzyme A by blocking its binding to target cells. Additionally, this antibody has been used in experiments to study the effects of granzyme A on dopamine release, hormone peptide processing, and liver microsome metabolism. With its high specificity and affinity for granzyme A, this monoclonal antibody is a valuable tool for researchers studying immune regulation and cell signaling pathways.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal TPH1 antibody (Ser260)

FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

DISP1 antibody was raised in Rabbit using Human DISP1 as the immunogen

Affinity purified Rabbit polyclonal ASNA1 antibody

The DCTN1 antibody is a highly specialized monoclonal antibody that targets the DCTN1 protein. This protein plays a crucial role in various cellular processes, including intracellular transport and organization of microtubules. By specifically binding to the DCTN1 protein, this antibody can modulate its function and activity.

PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

CD25 antibody is a monoclonal antibody that specifically targets CD25, a glycoprotein expressed on the surface of activated T cells. It is commonly used in research and clinical settings to study and treat conditions related to T cell activation, such as autoimmune diseases and certain types of cancer.

Affinity purified Rabbit polyclonal DUSP26 antibody

Affinity purified Rabbit polyclonal BIVM antibody

The VMAT2 antibody is a highly specialized antibody that targets the vesicular monoamine transporter 2 (VMAT2). This transporter is responsible for packaging and transporting neurotransmitters such as dopamine, serotonin, and norepinephrine into synaptic vesicles. By targeting VMAT2, this antibody can modulate the release of these neurotransmitters, making it a valuable tool in neuroscience research.

DDX21 antibody was raised in Rabbit using Human DDX21 as the immunogen

The NOSIP antibody is a highly specialized antibody that targets endothelial growth factors. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the Life Sciences field. This antibody has been extensively tested and validated for its specificity and sensitivity.

Phospho MBP antibody was raised in mouse using a sythetic peptide corresponding to the human myelin basic protein sequence phosphorylated at Thr98 and coupled to tuberculin as the immunogen.

Rabbit polyclonal GRIN2B antibody (Tyr1252)

Affinity purified Rabbit polyclonal Tuftelin 1 antibody

Affinity purified Rabbit polyclonal alpha Tubulin 1A antibody

Affinity purified Rabbit polyclonal Adenosine A2AR antibody

Affinity purified Rabbit polyclonal NAT2 antibody

The C-peptide antibody is a monoclonal antibody that is used for various applications in medical research and diagnostics. It is designed to specifically target and bind to the C-peptide, a peptide released during the processing of proinsulin into insulin. This antibody has been extensively characterized and validated for its high specificity and sensitivity.

Rabbit polyclonal MOR antibody (Ser375)

Rabbit polyclonal GABBR1 antibody (Ser923) (R1-Subunit)

RPL7 antibody was raised in rabbit using the C terminal of RPL7 as the immunogen

PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS

Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.

The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.

UTS2D antibody was raised in rabbit using the C terminal of UTS2D as the immunogen

CD45.2 antibody was raised in mouse using CD45.2 as the immunogen.

PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.

CHMP1B antibody was raised in Rabbit using Human CHMP1B as the immunogen

Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.

DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.

The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.

KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Affinity purified Rabbit polyclonal Cofilin 2 antibody

Rabbit polyclonal IKK gamma antibody

Rabbit polyclonal CKS1 antibody

The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.

Affinity purified Rabbit polyclonal CBFA1 antibody

TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen

Purified Polyclonal N4BP1 antibody

ALDH7A1 antibody was raised in Rabbit using Human ALDH7A1 as the immunogen

The THBS2 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to CD33, a receptor protein involved in various biological processes. It can be used for research purposes, such as studying receptor binding and identifying binding proteins. Additionally, the THBS2 antibody has applications in diagnostics and therapeutics.

Goat anti human IgG is a highly effective inhibitor that targets antibodies, specifically sorafenib, in human serum. It has been extensively studied and proven to be effective in various applications, including electrochemical impedance in Life Sciences and immunoassays. This inhibitor works by blocking the activity of phosphatase, preventing the dephosphorylation of target proteins. Additionally, it can be used as a solubilizing agent for monoclonal antibodies, ensuring their stability and functionality. Goat anti human IgG is commonly used in research laboratories and pharmaceutical industries due to its high specificity and reliability. With its ability to bind to glycoproteins and induce fas-mediated apoptosis, this product offers a wide range of possibilities for experimental studies and therapeutic applications.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.