Primary Antibodies

Fractalkine antibody is an antigen-specific antibody that targets the chemokine known as fractalkine. It is commonly used in Life Sciences research and is available in both polyclonal and monoclonal forms. This antibody has the ability to bind to fractalkine, leading to lysis or cross-linking of the target molecule. The activated antibody can also be used as a neutralizing agent against extracellular polysaccharides. Fractalkine antibody is widely used in various applications, including immunohistochemistry, flow cytometry, and Western blotting, to study the role of fractalkine in different biological processes. With its high specificity and affinity for fractalkine, this antibody provides researchers with a valuable tool for investigating the functions and mechanisms of this important chemokine in various contexts.

Affinity purified Rabbit polyclonal ULK2 antibody

Affinity purified Rabbit polyclonal DPRP1 antibody

ATP11B antibody was raised in Rabbit using Human ATP11B as the immunogen

The MTA1 antibody is a highly specific monoclonal antibody that targets the MTA1 protein. It is commonly used in life sciences research to study various cellular processes and pathways. The MTA1 protein plays a crucial role in gene regulation and has been implicated in cancer progression and metastasis.

MYOT antibody was raised in Rabbit using Human MYOT as the immunogen

Affinity purified Rabbit polyclonal SGTA antibody

Rabbit polyclonal FAKD1 antibody

The Amylin antibody is a powerful tool in the field of Life Sciences. This antibody has the ability to interfere with e-cadherin expression, making it an essential component for research related to cell adhesion and migration. It is available in both polyclonal and monoclonal forms, offering researchers flexibility in their experimental design.

The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.

The RBP1 antibody is a highly specialized polyclonal antibody that is used in various life sciences assays. It is specifically designed to target and bind to the RBP1 protein, which plays a crucial role in glucose transportation and dopamine regulation. This antibody is produced by immunizing animals with the specific antigen, resulting in the generation of high-affinity antibodies that can recognize and bind to the target protein.

ALDH1B1 antibody was raised in Rabbit using Human ALDH1B1 as the immunogen

DOK5 antibody was raised in Rabbit using Human DOK5 as the immunogen

Rabbit polyclonal CDH10 antibody

Purified Polyclonal RPL28 antibody

Rabbit polyclonal Alpha enolase antibody (biotin)

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

NDOR1 antibody was raised in Rabbit using Human NDOR1 as the immunogen

The FUS antibody is a polyclonal antibody that specifically targets the FUS protein. It recognizes the glycan structure present on the FUS protein and has neutralizing properties, making it an effective tool for studying the function of this protein. The FUS antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to have neuroprotective effects and can be used as a therapeutic agent in neurodegenerative diseases. Additionally, the FUS antibody can be used to study glycosylation processes and investigate the role of glycopeptides in cellular functions. In life sciences research, this antibody is widely used as an anti-connexin agent due to its ability to disrupt gap junctions between cells. Furthermore, it has been found to interact with collagen, suggesting potential applications in tissue engineering and regenerative medicine.

Affinity purified Rabbit polyclonal IL17 Receptor D antibody

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Affinity purified Rabbit polyclonal DYNC1I2 antibody

The Troponin T antibody is an immunosuppressant that belongs to the group of polyclonal antibodies. It specifically targets calmodulin, a protein involved in muscle contraction and relaxation. This antibody is buffered and has neutralizing properties, making it highly effective in inhibiting the activity of calmodulin. In addition to its immunosuppressive effects, the Troponin T antibody has been shown to promote the growth of factors that regulate cell proliferation and differentiation. It also exhibits diuretic properties by enhancing the excretion of fluids from the body. This antibody is widely used in life sciences research, particularly in studies involving interleukin-6 and other cytokines. The Troponin T antibody is available as a monoclonal antibody, which ensures high specificity and affinity for its target antigen. Its versatility extends beyond research applications, as it can also be used for diagnostic purposes, such as detecting influenza hemagglutinin or monitoring signaling pathways involving PI3-kinase

The FER antibody is a powerful tool used in life sciences research for the detection and analysis of messenger RNA (mRNA). It belongs to the category of antibodies, specifically polyclonal antibodies. This cytotoxic antibody is designed to target specific proteins, particularly glycoproteins, and can be used for various applications such as protein immobilization and chromatographic purification. The FER antibody has the unique ability to neutralize binding proteins, including growth factors like hepatocyte growth factor and angiopoietin-like 3 (ANGPTL3). Its high specificity and sensitivity make it an invaluable asset in the field of molecular biology and biomedical research.

Affinity purified Goat polyclonal Presenilin 2 antibody

The RPA70 antibody is a highly specific reagent used in scientific research for various applications. It is commonly used in polymerase chain reactions (PCR) and immunohistochemical detection to study protein-protein interactions and cellular processes. This polyclonal antibody recognizes the RPA70 protein, which plays a crucial role in DNA replication and repair.

Affinity purified Rabbit polyclonal GIMAP8 antibody

The RALB antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the RALB protein, which plays a crucial role in various cellular processes such as epidermal growth factor signaling, low-molecular-weight chemokine production, and endothelial cell growth. This antibody has been extensively used in research to study the function and regulation of RALB.

Affinity purified Rabbit polyclonal Glucocorticoid Receptor beta antibody

The IDO antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme indoleamine 2,3-dioxygenase (IDO). This enzyme plays a crucial role in the regulation of immune responses and is involved in various physiological processes. The IDO antibody has been extensively used to study the function and activity of IDO in different cell types and tissues.

The PP2A antibody is a highly specialized electrode used for the detection and analysis of Polyclonal Antibodies. This antibody is specifically designed to target and bind to adipocyte markers, allowing for accurate identification and characterization of these cells. The PP2A antibody has been shown to be effective in detecting acidic glycosylation patterns on adipocytes, which play a crucial role in their function and metabolism. Additionally, this antibody has been found to modulate superoxide production in adipocytes, suggesting a potential therapeutic application in oxidative stress-related disorders. Furthermore, studies have shown that the PP2A antibody can enhance e-cadherin expression in adipocytes, promoting cellular adhesion and insulin sensitivity. With its high specificity and sensitivity, the PP2A antibody is an invaluable tool for researchers in the field of Life Sciences studying interferon signaling pathways, adipose tissue biology, fatty acid metabolism, and more.

Rabbit polyclonal EGF antibody (biotin)

Rabbit polyclonal PCSK5 antibody

The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.

Factor VII antibody is a polyclonal antibody that targets the activated form of factor VII, a surface glycoprotein involved in the coagulation cascade. This antibody has been widely used in life sciences research to study the role of factor VII in various physiological processes. It has been shown to inhibit factor VII activity and gluconeogenesis in vitro. Additionally, this antibody has been used as a tool in multi-agent chemotherapy studies to investigate its potential therapeutic effects. Factor VII antibody can be used in various applications such as immunoassays, electrophoresis, and Western blotting to detect and quantify factor VII levels in samples. Its high specificity and sensitivity make it an essential tool for researchers studying coagulation pathways and related disorders.

AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.

Rabbit polyclonal TLR2 antibody (Middle Region)

The HIPK2 antibody is a highly specialized tool used in Life Sciences research. It is a Polyclonal Antibody that is designed for the ultrasensitive detection and neutralization of clostridial neurotoxins. The antibody can be immobilized on a carbon electrode, allowing for electrochemical impedance spectroscopy to be performed. This technique enables researchers to accurately measure the presence and activity of the toxins in various samples.

ACTA1 antibody was raised in rabbit using the N terminal of ACTA1 as the immunogen

The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.

TBCD antibody was raised in rabbit using the N terminal of TBCD as the immunogen

The UBE2L3 antibody is a highly specialized antibody used in life sciences research. It is designed to target and bind to the UBE2L3 protein, which plays a crucial role in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.

Purified Polyclonal NEIL3 antibody

Affinity purified Rabbit polyclonal XPNPEP2 antibody

Goat anti Pig IgM secondary antibody (Alk Phos)

The ERG antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the ERG protein, which plays a critical role in cellular processes such as collagen production and TGF-beta1 signaling. This antibody can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The ERG antibody is designed to provide accurate and reliable results, ensuring the highest level of specificity and sensitivity. It can be used with various enzyme substrates and detection systems to achieve optimal performance. Whether you are studying cell signaling pathways or investigating disease mechanisms, the ERG antibody is an invaluable tool for your research needs. With its exceptional quality and performance, this antibody will help advance your scientific discoveries in the field of Life Sciences.

CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.

RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA

Affinity purified Rabbit polyclonal Tetraspan 1 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.