Primary Antibodies

The PACAP antibody is a proteolytic monoclonal antibody that targets the cyclase-activating peptide (PACAP). It has been shown to exhibit cell cytotoxicity by binding to the conformational epitope of PACAP. This antibody can be used in various applications in the field of Life Sciences, including research on growth factors and as a vaccine adjuvant composition. The PACAP antibody specifically recognizes and binds to PACAP, which is involved in numerous biological processes such as glutamate release and regulation of hormone secretion. Additionally, this antibody has been used in hybridization studies to investigate the expression pattern of PACAP in different tissues. Its ability to modulate cyclase activation makes it a valuable tool for studying signaling pathways mediated by PACAP and its interaction with other molecules such as epidermal growth factor.

Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Affinity purified Rabbit polyclonal BIVM antibody

CD11c antibody (FITC) was raised in Mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.

The PMVK antibody is a highly specialized monoclonal antibody that acts as a family kinase inhibitor. It is colloidal in nature and has been extensively studied for its potential to inhibit endothelial growth. This antibody specifically targets the alpha-fetoprotein, which plays a crucial role in tumor development and progression.

Rabbit polyclonal GRIA1 antibody (Ser831)

Affinity purified Rabbit polyclonal Importin 7 antibody

IPO4 antibody was raised in Rabbit using Human IPO4 as the immunogen

The Carbonic Anhydrase I antibody is a growth factor that belongs to the Life Sciences category. It acts as a steroid inhibitor and is commonly used in research and laboratory settings. This antibody specifically targets carbonic anhydrase I, an enzyme involved in the regulation of pH balance in the body. The Carbonic Anhydrase I antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It has been extensively studied for its inhibitory effects on hepatocyte growth factor and leukemia inhibitory factor, making it a valuable tool in understanding these pathways. Additionally, this antibody has been used in studies involving annexin and c-myc proteins, further expanding its potential applications. Researchers can rely on the high quality and specificity of this antibody to enhance their experiments and gain valuable insights into cellular processes.

The MAP2 antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in neutralizing the effects of glutamate, a growth factor involved in various cellular processes. This monoclonal antibody specifically targets endothelial growth and has been shown to inhibit the proliferation and migration of endothelial cells. Additionally, it has been found to bind to alpha-synuclein, a protein associated with neurodegenerative diseases like Parkinson's. The MAP2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific needs. Its application extends beyond basic research, as it can be used in studies involving mesenchymal stem cells and microvessel density analysis. With its high specificity and sensitivity, the MAP2 antibody is an invaluable tool for scientists aiming to understand complex biological processes at the molecular level.

Synaptopodin antibody was raised in mouse using rat kidney glomeruli as the immunogen.

The PIAS4 antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein known as PIAS4, which stands for Protein Inhibitor of Activated STAT 4. PIAS4 is involved in various cellular processes, including epidermal growth factor signaling and interferon response.

The TP53 antibody is a glycoprotein that specifically targets the TP53 protein, also known as the tumor protein p53. This antibody is widely used in life sciences research to study the expression and function of TP53. It can be used in various applications such as Western blotting, immunohistochemistry, and immunoprecipitation. The TP53 antibody has been shown to have high specificity and sensitivity in detecting TP53 in nuclear extracts and human serum samples. This monoclonal antibody recognizes both wild-type and mutant forms of TP53, making it a valuable tool for studying the role of TP53 in cancer development and progression. With its superior performance and reliable results, the TP53 antibody is an essential reagent for researchers in the field of molecular biology and oncology.

Rabbit polyclonal Collagen XXV antibody

The GHRH Receptor antibody is a specific antibody that targets the growth hormone-releasing hormone (GHRH) receptor. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown to have neutralizing effects on the GHRH receptor, inhibiting its activity and downstream signaling pathways.

NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

Keratin K27 antibody was raised in Guinea Pig using synthetic peptide of human keratin K27 coupled to KLH as the immunogen.

Rabbit polyclonal SECP43 antibody

Purified Polyclonal ENT1 antibody

TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Rabbit polyclonal UGP2 antibody

CUL4B antibody was raised in Rabbit using Human CUL4B as the immunogen

Mouse monoclonal Sialosyl-Tn antigen antibody (FITC)

JUP antibody was raised in Rabbit using Human JUP as the immunogen

C20ORF3 antibody was raised using the N terminal Of C20Orf3 corresponding to a region with amino acids EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Rabbit polyclonal VPS41 antibody

The Tau antibody is a highly specialized monoclonal antibody that targets the insulin protein. It has been extensively studied in the field of Life Sciences and has shown remarkable potential for neutralizing insulin activity. This antibody specifically binds to insulin, inhibiting its function and preventing it from interacting with its receptors.

The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.

Affinity purified Rabbit polyclonal FSD2 antibody

The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.

Rabbit polyclonal PARK2 antibody (Ser101)

CHRNA4 antibody was raised in rabbit using the N terminal of CHRNA4 as the immunogen

PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ

human Albumin antibody was raised in goat using Purified human Albumin as the immunogen.

Affinity purified Rabbit polyclonal NEGR1 antibody

Purified Polyclonal SERINC2 antibody

Mouse monoclonal TOMM34 antibody

MAP4K2 antibody was raised in Rabbit using Human MAP4K2 as the immunogen

Rabbit polyclonal NGAL antibody (FITC)

TSHR antibody is a monoclonal antibody that acts as an inhibitor of the epidermal growth factor family kinase. It specifically targets and binds to the thyroid-stimulating hormone receptor (TSHR) in the nucleus, preventing its activation by autoantibodies. This antibody has been shown to exhibit cytotoxic effects on cells expressing TSHR, inhibiting their growth and proliferation. Additionally, it has been found to modulate the activity of transforming growth factor-beta 1 (TGF-β1), a potent growth factor involved in various cellular processes. TSHR antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its use has also been associated with reduced superoxide production and protection against thrombocytopenia. With its ability to target TSHR and influence key signaling pathways, this antibody holds great potential for research in the fields of thyroid biology, autoimmune diseases, and cancer therapy.

ATP6V1A antibody was raised in Rabbit using Human ATP6V1A as the immunogen

LASP1 antibody was raised in Rabbit using Human LASP1 as the immunogen

The MCL1 antibody is a highly specialized monoclonal antibody that targets the phosphatase growth factor. It has been specifically designed to neutralize tyrosine and colloidal substances in the body, making it an effective tool for various medical applications. This antibody has shown promising results in inhibiting the activity of glial fibrillary acidic proteins, which are associated with neurodegenerative diseases. Additionally, it has demonstrated its efficacy in targeting and neutralizing the circumsporozoite protein, making it a potential candidate for the development of vaccines against certain infectious diseases. The MCL1 antibody is a valuable asset in the field of medical research and holds great promise for future therapeutic interventions.

PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ

AChE antibody was raised in mouse using purified human cerebellar acetylcholinesterase as the immunogen.

Affinity purified Rabbit polyclonal CCDC83 antibody

HRC antibody was raised in Rabbit using Human HRC as the immunogen

Rabbit polyclonal INHBB antibody

Purified Polyclonal PLA2G4C antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.