Primary Antibodies

Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.

ASGR1 antibody was raised in Rabbit using Human ASGR1 as the immunogen

Affinity purified Rabbit polyclonal Surfactant Protein A antibody

Purified Rabbit polyclonal MKK10-2 antibody

The LOX antibody is a growth factor that belongs to the glycoprotein family. It is widely used in Life Sciences research for its ability to inhibit phosphatase activity. This monoclonal antibody can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry. The LOX antibody specifically targets human serum and has been shown to interact with fibronectin, collagen, alpha-fetoprotein, dopamine, and other proteins. Its high specificity and affinity make it an excellent tool for studying the role of LOX in various biological processes. Whether you're investigating cancer development or tissue remodeling, the LOX antibody is a valuable asset in your research arsenal.

Affinity purified Rabbit polyclonal I309 antibody

The CD105 antibody is a monoclonal antibody that is used in various applications related to angiogenesis and antiangiogenic therapy. It specifically targets CD105, also known as endoglin, which is a marker for microvessel density. The CD105 antibody works by binding to the antigen and forming an antigen-antibody complex, which can be detected using different techniques such as fluorescence immunochromatography or polymerase chain reaction (PCR). This specific antibody has been shown to be effective in detecting angiogenic factors and autoantibodies in human serum samples. Its high specificity and sensitivity make it a valuable tool for research and clinical diagnostics.

Rat monoclonal CIRE antibody (PE)

MIP1 beta antibody (biotin) was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.

Rabbit polyclonal PPCS antibody

Rabbit polyclonal PTPN18 antibody

RPS9 antibody was raised in rabbit using the C terminal of RPS9 as the immunogen

MAT2B antibody was raised in Rabbit using Human MAT2B as the immunogen

The Fibrinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to fibrinogen, a glycoprotein involved in blood clot formation. This antibody has been extensively studied and has shown great potential in various research applications.

ITGA5 antibody was raised in Rabbit using Human ITGA5 as the immunogen

PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD

Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.

Affinity purified Rabbit polyclonal AKT1/2 antibody

WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Affinity purified Rabbit polyclonal AGR3 antibody

CDC73 antibody was raised in Rabbit using Human CDC73 as the immunogen

IL23 antibody is an immunosuppressant that belongs to the class of monoclonal antibodies. It specifically targets IL-23, a cytokine involved in immune responses and inflammation. By binding to IL-23, this antibody prevents its interaction with its receptor, thereby inhibiting the downstream signaling pathways that lead to inflammation. IL23 antibody has been shown to effectively reduce the production of pro-inflammatory cytokines and inhibit the activation of immune cells. This antibody is commonly used in research and clinical settings to study the role of IL-23 in various diseases, including autoimmune disorders and cancer. Its high specificity and potency make it a valuable tool for investigating the therapeutic potential of targeting IL-23 in these conditions.

The iNOS antibody is a neuroprotective monoclonal antibody that targets inducible nitric oxide synthase (iNOS). It is commonly used in Life Sciences research and has shown promising results in various studies. This antibody specifically binds to iNOS, inhibiting its activity and preventing the production of nitric oxide. Nitric oxide is a signaling molecule that plays a role in various physiological processes, including inflammation and neuronal signaling. By blocking iNOS, the antibody can help reduce inflammation and protect neurons from damage.

The JNK antibody is a highly specialized monoclonal antibody that targets the protein kinase known as JNK (c-Jun N-terminal kinase). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various assays. It has been found to inhibit the activation of JNK, which plays a crucial role in cellular processes such as apoptosis, inflammation, and glucose metabolism. Additionally, this antibody has shown potential in targeting other proteins like prorenin and sclerostin. With its high specificity and efficacy, the JNK antibody is a valuable tool for researchers in their quest to understand and manipulate cellular signaling pathways.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to effectively treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

DLEU1 antibody was raised in Rabbit using Human DLEU1 as the immunogen

Mouse anti-25OH Vitamin D2/D3 antibody

The Pyruvate Kinase antibody is a highly specialized monoclonal antibody that targets the pyruvate kinase enzyme. This antibody has been extensively studied in the field of Life Sciences and has shown significant potential for use in various applications. It exhibits cytotoxic activity against cancer cells, making it a promising candidate for targeted therapies. Additionally, this antibody has been found to interact with fibronectin, collagen, and other glycoproteins, indicating its potential role in cell adhesion and migration processes. Furthermore, studies have demonstrated that the Pyruvate Kinase antibody can modulate the production of interleukin-6 and activate the p38 MAPK pathway. With its unique properties and versatility, this antibody holds great promise for further research and development in the fields of oncology, immunology, and drug discovery.

CSH2 antibody was raised in Rabbit using Human CSH2 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting potent bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, hindering transcription and replication processes in bacteria. Extensive research has shown its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.

Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Affinity purified Rabbit polyclonal KCC4 antibody

Benzoylecgonine antibody was raised in mouse using benzoylecgonine-KLH Conjugate as the immunogen.

D2HGDH antibody was raised in Rabbit using Human D2HGDH as the immunogen

The SLK antibody is a growth factor that plays a crucial role in various biological processes. It is a colloidal glycosylation antibody that can be used for research purposes in the Life Sciences field. This antibody specifically targets insulin, a protein involved in regulating glucose metabolism. The SLK antibody can be used in assays to detect and quantify insulin levels in samples. It is also commonly used as a tool for studying insulin signaling pathways and investigating the function of insulin in different cellular processes. Additionally, this antibody can be used to activate alkaline phosphatases and detect monoclonal antibodies or anti-ACTH antibodies. Its versatility and specificity make it an essential tool for researchers in the Life Sciences field.

Rabbit polyclonal MARCKS antibody (Ser152,156)

Mouse monoclonal ZIM2 antibody

Rabbit polyclonal TR19L antibody

ATXN10 antibody was raised in Rabbit using Human ATXN10 as the immunogen

Rad9 antibody is a monoclonal antibody that specifically binds to Rad9, a protein involved in DNA damage response and repair. This antibody has been shown to be highly effective in detecting Rad9 in various biological samples, including pleural fluid and human serum. It can be used for research purposes in the field of life sciences to study the role of Rad9 in cellular processes such as DNA repair, cell cycle regulation, and apoptosis. Additionally, Rad9 antibody has antiangiogenic properties and can inhibit endothelial growth by binding to specific receptors on endothelial cells. Its cytotoxic effects make it a promising candidate for targeted cancer therapy. With its high specificity and affinity for Rad9, this antibody is an invaluable tool for scientists studying biomolecules and their interactions.

RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG

The CD122 antibody is a highly effective tool used in Life Sciences research. This antibody specifically targets and binds to CD122 receptors, which are found on various cell types including immune cells, endothelial cells, and collagen-producing cells. By binding to CD122 receptors, this antibody modulates the signaling pathways involved in cell growth, differentiation, and survival.

EDN1 antibody was raised in Rabbit using Human EDN1 as the immunogen

Rabbit polyclonal HSPE1 antibody (FITC)

Affinity purified Rabbit polyclonal MORG1 antibody

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

The SSR3 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear receptor GLP-1 and has been widely used in various assays and experiments. The SSR3 antibody is highly specific and exhibits high affinity for its target, making it an ideal tool for studying the functions of GLP-1. This antibody has been successfully used in experiments involving electrode-based techniques, such as patch-clamp recordings, as well as in immunoassays to detect GLP-1 levels in human serum samples. Additionally, the SSR3 antibody has shown efficacy in cytotoxicity assays and has been used to study the effects of GLP-1 on cell growth and survival. Its versatility and reliability make it a valuable tool for researchers working in the field of Life Sciences.

BOLA1 antibody was raised in Rabbit using Human BOLA1 as the immunogen

Rabbit polyclonal GRIN1 antibody (Splice Variant C1)

The SCF antibody is a polyclonal antibody that has the ability to neutralize the activity of stem cell factor (SCF). Stem cell factor is an important growth factor involved in various cellular processes, including cell proliferation, differentiation, and survival. The SCF antibody can specifically bind to SCF and inhibit its function, preventing it from interacting with its receptor and initiating downstream signaling pathways.

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.