Primary Antibodies

<p>EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR</p>

<p>Rabbit polyclonal GLR antibody</p>

FBXO21 antibody was raised using the N terminal of FBXO21 corresponding to a region with amino acids KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS

Rat monoclonal Ly6G antibody (biotin)

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds known for their bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

Biotinylated Rabbit Anti-Human CTGF antibody

<p>Troponin I Type 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIP</p>

<p>The RGS4 antibody is a polyclonal antibody that targets the growth factor receptor. It specifically binds to the activated form of epidermal growth factor (EGF) and inhibits its signaling pathway. This antibody has been widely used in life sciences research to study the role of EGF in various cellular processes, including cell proliferation, migration, and differentiation. Additionally, the RGS4 antibody has shown cytotoxic effects on cancer cells expressing high levels of c-myc and HER2/neu receptors. It can be used in combination with other antibodies such as trastuzumab to enhance their efficacy. The high viscosity of this antibody solution allows for easy handling and ensures consistent results. Overall, the RGS4 antibody is a valuable tool for researchers studying growth factor signaling pathways and their role in disease progression.</p>

<p>The PCAF antibody is a monoclonal antibody that specifically targets the amino-terminal region of the PCAF protein. This antibody has been extensively studied and has shown promising results in various applications. It has been found to have neutralizing activity against TNF-α, a key cytokine involved in inflammatory processes. Additionally, the PCAF antibody has been shown to inhibit the formation of dimers of chemokine receptors, which are important for cell migration and activation.</p>

<p>SLC25A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS</p>

<p>Affinity purified Rabbit polyclonal ILBP antibody</p>

<p>Rabbit polyclonal ALPI antibody (FITC)</p>

<p>The Cofilin antibody is a powerful tool in the field of Life Sciences. It targets cofilin, a protein kinase that plays a crucial role in cell movement and migration. The antibody has been extensively tested and validated for its specificity and effectiveness in various applications.</p>

<p>Rabbit polyclonal TNIP2 antibody</p>

<p>Protein S antibody was raised in sheep using human Protein S purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal OR52E2 antibody</p>

The LOX antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and detects the anti-apoptotic protein LOX. With its ultrasensitive detection capabilities, this antibody allows for precise and accurate measurement of LOX levels in various samples.

Mouse anti-Gliadin antibody

GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS

<p>The FADD antibody is a highly specific and sensitive polyclonal antibody that is used in various research applications. It has been developed using state-of-the-art spectrometric and mass spectrometric methods to ensure its quality and reliability.</p>

<p>Rabbit polyclonal MAP2K6 antibody</p>

<p>Rabbit polyclonal PES1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug's effectiveness has been proven through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Its oxidative metabolites undergo hydrolysis by esterases, reduction by glutathione reductase, and oxidation by cytochrome p450 enzymes. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth. With its impressive features, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an indispensable tool in the fight against tuberculosis.</p>

<p>Rabbit polyclonal TOMM40 antibody</p>

<p>Rabbit polyclonal ARF5 antibody (FITC)</p>

<p>Crystallin Beta A1 antibody was raised using the N terminal of CRYBA1 corresponding to a region with amino acids METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS</p>

<p>Affinity purified Rabbit polyclonal MPP3 antibody</p>

Diphtheria toxin antibody was raised in mouse using Intact toxin/toxoid as the immunogen.

<p>Rabbit polyclonal GABRD antibody (N-Terminus)</p>

<p>CTSB antibody was raised in Rabbit using Human CTSB as the immunogen</p>

<p>The IkB alpha antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activated form of IkB alpha, a protein that plays a crucial role in cellular signaling pathways. By binding to IkB alpha, this antibody prevents its interaction with 14-3-3 isoforms, thereby inhibiting downstream signaling events.</p>

DIAPH3 antibody was raised in Rabbit using Human DIAPH3 as the immunogen

<p>The TOM20 antibody is a monoclonal antibody that has a wide range of applications in the field of Life Sciences. It specifically targets TOM20, a protein involved in mitochondrial import and sorting. This antibody can be used for various research purposes, including the detection and quantification of TOM20 in different biological samples.</p>

Mouse monoclonal ACY3 antibody

<p>Mouse monoclonal HSPA6 antibody</p>

<p>The DDX5 antibody is a powerful tool in the field of Life Sciences. It is an acid complex that consists of both polyclonal and monoclonal antibodies. This antibody specifically targets DDX5, a growth factor involved in various cellular processes. By binding to DDX5, the antibody can modulate its activity and inhibit its function.</p>

<p>The cFOS antibody is a highly effective inhibitor that is widely used in various assays and experiments. This monoclonal antibody specifically targets the cFOS protein, which plays a crucial role in cellular processes such as cell growth, differentiation, and apoptosis. By inhibiting the activity of cFOS, this antibody allows researchers to study the function and regulation of this protein in different biological systems.</p>

<p>The Progesterone Receptor antibody is a powerful tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, allowing for flexibility in experimental design. The antibody specifically targets the progesterone receptor, a key protein involved in various physiological processes.</p>

The ApoB antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying various biological processes, including tissue transglutaminase and the production of antibodies. This monoclonal antibody is designed to specifically bind to the recombinant antigen, allowing for accurate detection and analysis in assays. The ApoB antibody is buffered to ensure stability and optimal performance in experiments. With its high affinity and specificity, researchers can rely on this antibody to provide reliable results. Whether studying activated proteins or analyzing human serum samples, the ApoB antibody is a valuable asset in any laboratory setting.

<p>Rabbit polyclonal TAOK3 antibody</p>

<p>Goat anti-rat IgM (FITC) (mu chain specific) was raised in goat using rat IgM, Mu chain as the immunogen.</p>

<p>Mouse monoclonal DOK2 antibody</p>

<p>RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV</p>

<p>MED31 antibody was raised in Rabbit using Human MED31 as the immunogen</p>

<p>Purified Polyclonal ABL1/2 antibody</p>

<p>DYNC1I1 antibody was raised using the N terminal of DYNC1I1 corresponding to a region with amino acids IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP</p>

<p>The NUFIP1 antibody is a powerful medicament that acts as an interferon and carboxyl esterase inhibitor. It has antiviral properties and is commonly used in the development of vaccines. This antibody works by inhibiting the formation of antibodies, making it an effective tool for studying immune responses. Additionally, it can be used as a fluorescence probe in various life sciences applications. With its ability to bind to specific targets, the NUFIP1 antibody is a valuable tool for researchers and scientists working in the field of medicine and immunology.</p>

<p>Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE</p>

<p>KIAA0460 antibody was raised using the middle region of KIAA0460 corresponding to a region with amino acids LQGTLAEHFGVLPGPRDHGGPTQRDLNGPGLSRVRESLTLPSHSLEHLGP</p>

<p>MRPL45 antibody was raised in rabbit using the C terminal of MRPL45 as the immunogen</p>

<p>Mouse monoclonal SNX8 antibody</p>

Mouse monoclonal ILVBL antibody

<p>C3orf49 antibody was raised using the middle region of C3orf49 corresponding to a region with amino acids IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH</p>

<p>Affinity purified Rabbit polyclonal NR3C2 antibody</p>

<p>The TIMP2 antibody is a polyclonal antibody that is used in immunohistochemistry to detect the presence of TIMP2 (Tissue Inhibitor of Metalloproteinase 2) in various biological samples. This antibody specifically binds to the CXCR4 antigen, which is an acidic chemokine receptor involved in cell migration and immune response. The TIMP2 antibody can be immobilized on an electrode or used as a probe in various assays to study the activation and function of CXCR4. Additionally, this antibody has been used in antibody-drug conjugates for targeted therapy in cancer treatment. In life sciences research, the TIMP2 antibody is a valuable tool for studying the role of TIMP2 in cellular processes and disease progression, such as interferon signaling and transthyretin-related disorders.</p>

<p>TEAD2 antibody was raised in mouse using recombinant Human Tea Domain Family Member 2</p>

<p>The Estrogen Receptor alpha antibody is a highly specialized serine protease that is commonly used in Life Sciences. This antibody is colloidal in nature and belongs to the class of Polyclonal Antibodies. It has been specifically designed to target the estrogen receptor alpha, which plays a crucial role in various biological processes.</p>

Rabbit polyclonal UBE2N antibody

<p>FBXO3 antibody was raised using the N terminal of FBXO3 corresponding to a region with amino acids NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS</p>

<p>TEAD3 antibody is a valuable product in the field of Life Sciences. This antibody is widely used in research and pharmaceutical industries for its ability to detect and bind to TEAD3 protein. TEAD3 is an important transcriptional regulator that plays a crucial role in various cellular processes, including development, differentiation, and disease progression. The TEAD3 antibody is highly specific and sensitive, making it an ideal tool for studying the function and regulation of TEAD3 in different biological systems.</p>

<p>Rabbit polyclonal TXNDC12 antibody</p>

<p>Rabbit polyclonal OR2AG1 antibody</p>

<p>PTER antibody was raised in rabbit using the N terminal of PTER as the immunogen</p>

<p>CCDC72 antibody was raised in Rabbit using Human CCDC72 as the immunogen</p>

<p>CLCN1 antibody was raised in Rabbit using Human CLCN1 as the immunogen</p>

<p>Rabbit polyclonal TERF2 antibody</p>

<p>Rabbit polyclonal CXCL10 antibody (biotin)</p>

<p>Mouse monoclonal NIF3L1 antibody</p>

<p>GMPS antibody was raised in Rabbit using Human GMPS as the immunogen</p>

<p>MTHFD1L antibody was raised in Rabbit using Human MTHFD1L as the immunogen</p>

<p>CCT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE</p>

<p>Affinity purified Rabbit polyclonal CHRNA1 antibody</p>

<p>Rabbit Polyclonal WEE1 antibody (Ser642)</p>

<p>ODC antibody is a polyclonal antibody that specifically targets and binds to ornithine decarboxylase (ODC), a protein involved in the synthesis of polyamines. Polyamines play important roles in cell growth, proliferation, and differentiation. ODC antibody can be used in various applications in life sciences research, including the study of epidermal growth factor signaling pathways, autoantibodies associated with diseases such as heparin-induced thrombocytopenia, and the development of anti-HER2 antibody therapies. This antibody can also be used to detect ODC expression levels in different tissues or cell lines. The high specificity and sensitivity of ODC antibody make it an essential tool for researchers studying the role of polyamines in cellular processes and their potential as therapeutic targets.</p>

<p>The Caspase 7 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This polyclonal antibody specifically targets caspase 7, an enzyme involved in programmed cell death (apoptosis). It is widely used in life sciences research to study the mechanisms of apoptosis and its regulation.</p>

Mouse monoclonal ARFGAP1 antibody

<p>Purified Rabbit polyclonal MADS62 antibody</p>

VEGF Monoclonal Antibody (HRP)

The Aflatoxin antibody is a protein inhibitor that belongs to the class of Monoclonal Antibodies. It acts as a growth factor and can be used in various applications such as research in Life Sciences. This antibody specifically targets aflatoxins, which are toxic compounds produced by certain molds that contaminate food and feed crops. By binding to aflatoxins, the antibody prevents their harmful effects on human and animal health.

GTF2E2 antibody was raised in Rabbit using Human GTF2E2 as the immunogen

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their cell growth in culture.</p>

<p>CYP3A5 antibody was raised in Rabbit using Human CYP3A5 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, effectively stopping bacterial growth. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers highly expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>WNT10B antibody was raised in Mouse using a purified recombinant fragment of human WNT10B expressed in E. coli as the immunogen.</p>

Bovine RBC antibody (FITC) was raised in rabbit using bovine reythrocytes as the immunogen.

<p>Rabbit polyclonal GPR123 antibody</p>

Mouse monoclonal Complement C3 beta chain antibody

<p>SRPR antibody was raised using a synthetic peptide corresponding to a region with amino acids DSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAE</p>

<p>Purified Polyclonal ALDH3B2 antibody</p>

<p>ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL</p>

<p>The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.</p>

<p>Parainfluenza type 1 antibody</p>

<p>KCTD15 antibody was raised in mouse using recombinant human KCTD15 (1-234) purified from E.coli as the immunogen.</p>

<p>KIF22 antibody was raised using the C terminal of KIF22 corresponding to a region with amino acids LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ</p>

<p>Rabbit polyclonal SNX20 antibody</p>

<p>Rabbit polyclonal STRAD antibody</p>

Mouse monoclonal IL4 antibody (allophycocyanin)

<p>Affinity purified Rabbit polyclonal Ran BP1 antibody</p>

<p>The Cytokeratin 19 antibody is a highly effective polyclonal antibody that targets and binds to Cytokeratin 19, a protein that plays a crucial role in cell adhesion and differentiation. This antibody has been extensively tested and proven to be reliable in detecting the presence of Cytokeratin 19 in various biological samples.</p>

<p>E. coli 0157:H7 antibody (FITC) was raised in goat using whole cells of E. coli serotype 0157:H7 as the immunogen.</p>