Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
ADAMTS4 antibody
The ADAMTS4 antibody is a highly specialized protein that has cytotoxic properties and promotes the growth of keratinocytes and endothelial cells. It is commonly used in research and medical applications to study the function of ADAMTS4, a protein involved in various cellular processes. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of certain cells. Additionally, it has been shown to have neutralizing effects on other proteins such as anti-CD33 antibody, growth factors, and family kinase inhibitors. The ADAMTS4 antibody is a valuable tool for scientists and researchers working in fields such as immunology, oncology, and cell biology.
CLCA1 antibody
The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.
THC antibody
The THC antibody is a highly specific monoclonal antibody that is used for the detection of delta-9-tetrahydrocannabinol (THC). It is derived from hybridoma cells and has been extensively tested for its accuracy and reliability. The antibody is buffered and can be used with human serum samples.eNOS antibody
The eNOS antibody is a powerful tool used in the field of Life Sciences. It is designed to target and detect endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.
CtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
FGF9 antibody
The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.
COX2 antibody
The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.
CHAT antibody
The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.
C Peptide antibody
C Peptide antibody was raised in mouse using human C-peptide-BSA as the immunogen.Purity:>95% Pure By Sds-PageNR0B1 antibody
NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC
Desmin antibody
The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.
Pleiotrophin antibody
The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.
ALDH1A2 antibody
The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.
XRCC4 antibody
The XRCC4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the XRCC4 protein, which plays a crucial role in DNA repair and recombination. The antibody binds to the histidine-tagged XRCC4 protein, allowing for its detection and analysis in various experimental settings. This XRCC4 antibody is commonly used in studies involving pluripotent cells, collagen synthesis, lipoprotein lipase regulation, and immune response modulation. Additionally, it has been shown to interact with other proteins such as interferon, TGF-beta, and endothelial growth factors. The XRCC4 antibody offers researchers a valuable tool for investigating DNA repair mechanisms and understanding their implications in various biological processes.
LGALS14 antibody
LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI
Histone H2Ax antibody
The Histone H2Ax antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to the acidic histone protein H2Ax, which plays a crucial role in DNA repair and damage response. By detecting the presence of H2Ax, researchers can gain valuable insights into various cellular processes, including fibrinogen activation, growth factor signaling, and multidrug resistance.
Thyroid Peroxidase antibody
Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.
GPR120 antibody
The GPR120 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as a growth factor and has the ability to neutralize epidermal growth factor (EGF) and TGF-beta. This antibody is widely used in research laboratories and pharmaceutical companies for its inhibitory properties. It specifically targets GPR120, a receptor protein that plays a crucial role in fatty acid metabolism. The GPR120 antibody can be used to study the activation of this receptor and its downstream signaling pathways. Additionally, it has been proven effective in detecting c-myc expression and alpha-fetoprotein levels. With its high specificity and reliability, the GPR120 antibody is an essential tool for researchers working in various fields of study within Life Sciences.
ApoD antibody
The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.
p53 antibody
The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.
RAP1 antibody
The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.
Mouse IgG Purified
The purified Mouse IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.
Purity:>95% By Sds-PageRNF19A antibody
RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Purity:Min. 95%PTGES antibody
PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%CD11b antibody (PE)
CD11b antibody (biotin) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
