Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,621 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
GSTP1 antibody
The GSTP1 antibody is a monoclonal antibody that specifically targets the glutathione S-transferase P1 (GSTP1) protein. This protein plays a crucial role in cellular detoxification processes and is involved in the metabolism of various drugs and toxins. The GSTP1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in several areas.
C10ORF132 antibody
C10ORF132 antibody was raised using the N terminal Of C10Orf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQIL9 antibody
IL9 antibody was raised in rabbit using highly pure recombinant murine IL-9 as the immunogen.alpha 1 Antiplasmin antibody (HRP)
alpha 1 Antiplasmin antibody (HRP) was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.TCP11L2 antibody
TCP11L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQICDCUN1D4 antibody
DCUN1D4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL
AP1M2 antibody
AP1M2 antibody was raised using the N terminal of AP1M2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLTNFRSF1A antibody
TNFRSF1A antibody was raised in rabbit using the N terminal of TNFRSF1A as the immunogenFactor VIII antibody
Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.
EGFR antibody
EGFR antibody was raised in mouse using recombinant human EGFR (424-605aa) purified from E. coli as the immunogen.
TPRKB antibody
TPRKB antibody was raised using the middle region of TPRKB corresponding to a region with amino acids EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSCASP8 antibody
The CASP8 antibody is a highly specialized polyclonal antibody that has been biotinylated for enhanced detection capabilities. It specifically targets the elastase protein and bovine γ-globulin, making it an essential tool in various research applications within the Life Sciences field. The CASP8 antibody is also available in monoclonal form, providing consistent and reliable results.
NR2F1 antibody
NR2F1 antibody was raised using the N terminal of NR2F1 corresponding to a region with amino acids GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVTSH (intact) antibody
TSH (intact) antibody was raised against Human Thryoid Stimulating Hormone (TSH, intact).
PI4K2B antibody
PI4K2B antibody was raised using the middle region of PI4K2B corresponding to a region with amino acids IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGAIARS antibody
IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFGPPP1R11 antibody
PPP1R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN
PIK3R5 antibody
PIK3R5 antibody was raised using the N terminal of PIK3R5 corresponding to a region with amino acids HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSMDM2 antibody
The MDM2 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the MDM2 protein, which plays a crucial role in regulating cell growth and division. This antibody can be used to study the function of MDM2 in various cellular processes.
RBM11 antibody
RBM11 antibody was raised using the middle region of RBM11 corresponding to a region with amino acids SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRRat Myeloid Precursor Cells antibody
Rat myeloid precursor cells antibody was raised in rat using mouse macrophage precursor cells as the immunogen.CYSLTR2 antibody
The CYSLTR2 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor. It is specifically designed to neutralize the effects of this growth factor and has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting the activity of epidermal growth factor and Angptl3, which are known to play a crucial role in various cellular processes. The CYSLTR2 antibody is available as both polyclonal antibodies and low-molecular-weight dimers, making it suitable for a wide range of applications. Its high affinity for its target makes it an ideal tool for immunoassays and chromatographic techniques. With its exceptional specificity and neutralizing capabilities, the CYSLTR2 antibody is an invaluable asset for researchers in the field of Life Sciences.VDAC1 antibody
The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.
PSMD3 antibody
PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASPaxillin antibody
The Paxillin antibody is a highly specialized monoclonal antibody that targets the activated form of paxillin, an inhibitory factor involved in cell signaling pathways. This antibody has been extensively tested and shown to effectively neutralize the activity of paxillin, making it a valuable tool for researchers studying cell growth and development. Additionally, this antibody has been found to have high substrate specificity, meaning it only binds to the activated form of paxillin and not other related proteins. This specificity ensures accurate and reliable results in experiments involving paxillin signaling. The Paxillin antibody is also available as polyclonal antibodies for use in a wider range of applications. These antibodies have been validated for use in primary cells and are widely used in life sciences research. Whether you're studying interferon signaling, interleukin-6 regulation, or leukemia inhibitory factor activity, the Paxillin antibody is an essential tool for your research needs.EIF3EIP antibody
EIF3EIP antibody was raised using the N terminal of EIF3EIP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVTACC3 antibody
TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKESRPS3 antibody
The RPS3 antibody is a highly specialized monoclonal antibody that targets the histidine-rich protein S3 (RPS3). This antibody has been extensively studied in the field of Life Sciences and has shown promising results as an antiviral agent. It has been found to neutralize the activity of caspase-9, a key enzyme involved in apoptosis, and inhibit the growth of various viruses. The RPS3 antibody can also be used for research purposes, such as in Western blotting or immunohistochemistry assays. With its high specificity and affinity for the target molecule, this antibody is a valuable tool for scientists studying cellular signaling pathways, including those involving TGF-beta and epidermal growth factor. Whether you're conducting groundbreaking research or developing new therapeutic strategies, the RPS3 antibody is an essential component of your scientific toolkit.Caldesmon 1 antibody
Caldesmon 1 antibody was raised using the C terminal of CALD1 corresponding to a region with amino acids VLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLMEK1 antibody
The MEK1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to MEK1, a protein involved in signal transduction pathways. This antibody can be used for various applications, including research on androgen signaling, plasmid expression systems, adipose tissue biology, and hybridization techniques.p53 antibody
The p53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the p53 protein, which is a key regulator of cell growth and division. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and flow cytometry.
HAL antibody
HAL antibody was raised using the C terminal of HAL corresponding to a region with amino acids EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKTOR1B antibody
TOR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID
AVPR1B antibody
The AVPR1B antibody is a highly effective monoclonal antibody that targets the AVPR1B receptor. This receptor plays a crucial role in various biological processes, including the regulation of stress response and social behavior. By specifically binding to the AVPR1B receptor, this antibody inhibits its activity and modulates the downstream signaling pathways.phospho MBP antibody
Phospho MBP antibody was raised in mouse using a sythetic peptide corresponding to the human myelin basic protein sequence phosphorylated at Thr98 and coupled to tuberculin as the immunogen.
NOSIP antibody
The NOSIP antibody is a highly specialized antibody that targets endothelial growth factors. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the Life Sciences field. This antibody has been extensively tested and validated for its specificity and sensitivity.
ATF4 antibody
The ATF4 antibody is a highly specific polyclonal antibody that is used in various life science applications. It specifically targets the activating transcription factor 4 (ATF4), which plays a crucial role in cellular processes such as growth, differentiation, and stress response.
PDCD2 antibody
The PDCD2 antibody is a highly specialized monoclonal antibody that targets a specific molecule in human hepatocytes. It is designed to recognize and bind to the carboxyl terminal of the target molecule, allowing for precise detection and analysis. This antibody is derived from a hybridoma cell line, resulting in a chimeric protein that combines the specificity of human antibodies with the stability of bovine γ-globulin. The PDCD2 antibody has been extensively tested in various Life Sciences applications, including hybridization studies and immunohistochemistry. Its unique properties make it an invaluable tool for researchers studying natriuretic factors, chemokines, and other important signaling molecules. Trust the PDCD2 antibody to provide accurate and reliable results in your experiments.KCNA10 antibody
KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW
VMAT2 antibody
The VMAT2 antibody is a highly specialized antibody that targets the vesicular monoamine transporter 2 (VMAT2). This transporter is responsible for packaging and transporting neurotransmitters such as dopamine, serotonin, and norepinephrine into synaptic vesicles. By targeting VMAT2, this antibody can modulate the release of these neurotransmitters, making it a valuable tool in neuroscience research.
PEG10 antibody
The PEG10 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor GM-CSF (colony-stimulating factor). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications. It has been found to inhibit the activity of phosphatase, which plays a crucial role in cell growth and differentiation. Additionally, the PEG10 antibody has been shown to have an impact on adipocyte function, making it a promising candidate for research in obesity and metabolic disorders. With its high specificity and affinity for its target, this antibody is a valuable tool for scientists working in various areas of biomedical research.MGC51025 antibody
MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKHPLAT antibody
The PLAT antibody is a monoclonal antibody that specifically targets fibrinogen. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody has shown excellent binding affinity and specificity for fibrinogen, making it an ideal tool for various experimental techniques.Vitronectin antibody
Vitronectin antibody was raised in sheep using human Vitronectin purified from plasma as the immunogen.CD25 antibody
CD25 antibody is a monoclonal antibody that specifically targets CD25, a glycoprotein expressed on the surface of activated T cells. It is commonly used in research and clinical settings to study and treat conditions related to T cell activation, such as autoimmune diseases and certain types of cancer.
Keratin 15 antibody
The Keratin 15 antibody is a glycopeptide that targets the human serum androgen. It is an essential tool for researchers in the field of Life Sciences, as it plays a crucial role in various cellular processes. This antibody specifically recognizes Keratin 15, which is a protein involved in the maintenance and integrity of epithelial tissues.PPIF antibody
PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
