Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CACNB2 antibody
CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids AYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSAApoA antibody
ApoA antibody was raised in Mouse using a purified recombinant fragment of ApoA(4330-4521) expressed in E. coli as the immunogen.HDAC7 antibody
The HDAC7 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to HDAC7, an enzyme involved in endothelial growth. This monoclonal antibody is produced by hybridoma cells and has been extensively tested for its specificity and reliability.Tetraspanin 32 antibody
Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD
CKMM antibody
The CKMM antibody is a specific monoclonal antibody that targets creatine kinase MM (CKMM). This antibody has been extensively studied in the field of Life Sciences and has shown great potential in various applications. CKMM is an enzyme involved in energy metabolism, specifically in the conversion of creatine to phosphocreatine, which plays a crucial role in muscle contraction.ATP8B2 antibody
ATP8B2 antibody was raised using the N terminal of ATP8B2 corresponding to a region with amino acids KTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVP
SHBG Antibody
The SHBG Antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets and binds to sex hormone-binding globulin (SHBG), a protein that plays a crucial role in regulating the bioavailability of insulin and other hormones. By binding to SHBG, this antibody disrupts its function, leading to cytotoxic effects on cells.
BLNK antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections by targeting the active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.TSH antibody
TSH antibody is a monoclonal antibody that is commonly used in Life Sciences research. It is specifically designed to target and bind to the thyroid-stimulating hormone (TSH) receptor. This antibody has been extensively studied and proven to be highly effective in various applications.ACP1 antibody
ACP1 antibody was raised using the N terminal of ACP1 corresponding to a region with amino acids PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPRAB40C antibody
RAB40C antibody was raised using the N terminal of RAB40C corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYSDYDC1 antibody
DYDC1 antibody was raised using the middle region of DYDC1 corresponding to a region with amino acids EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
Desmin antibody
Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRPKD1 antibody
The PKD1 antibody is a highly specific and potent antibody that is used in the field of Life Sciences. It is derived from human serum and belongs to the class of Polyclonal Antibodies. This antibody targets the PKD1 protein, which plays a crucial role in various cellular processes. It has been extensively studied and validated for its ability to detect and quantify PKD1 levels in biological samples.
CDH8 antibody
The CDH8 antibody is a neuroprotective glycopeptide that exhibits low pH-dependent protease activity. This antibody specifically targets and neutralizes CDH8, a cholinergic receptor involved in various life sciences processes. It is available as both a monoclonal and polyclonal antibody. The CDH8 antibody has been shown to inhibit the proteolytic activity of calpain, a calcium-dependent protease, and enhance the activity of growth factors and phosphatases. With its unique properties, this antibody offers promising applications in neurobiology research and therapeutic interventions.Renin antibody
Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAHemoglobin Zeta antibody
Hemoglobin Zeta antibody was raised using the N terminal of HBZ corresponding to a region with amino acids ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAFAK antibody
FAK antibody was raised in Mouse using a purified recombinant fragment of FAK expressed in E. coli as the immunogen.GATA4 antibody
GATA4 antibody was raised in Mouse using a purified recombinant fragment of human GATA4 expressed in E. coli as the immunogen.IGSF1 antibody
IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
Syntaxin 19 antibody
Syntaxin 19 antibody was raised using the N terminal of STX19 corresponding to a region with amino acids LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR
IDO2 antibody
The IDO2 antibody is a highly specialized monoclonal antibody that targets the indoleamine 2,3-dioxygenase 2 (IDO2) protein. This antibody specifically recognizes and binds to IDO2, inhibiting its activity. IDO2 is an enzyme involved in the metabolism of tryptophan, an essential amino acid. By inhibiting IDO2, this antibody helps regulate the levels of tryptophan and other metabolites in various biological processes.MX1 antibody
The MX1 antibody is a polyclonal antibody that has neutralizing properties against the virus surface antigen. It is commonly used in life sciences research to study the anticoagulant and chemokine functions of MX1. This antibody can be used in various applications, including mass spectrometric methods and protein kinase assays. It has been shown to effectively inhibit the activation of protein kinase 3-kinase in human serum. The MX1 antibody is a valuable tool for researchers studying interferon-related pathways and viral infections.VPS35 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target tuberculosis infection and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its effectiveness has been demonstrated through various techniques such as the patch-clamp technique on human erythrocytes. This drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
PDGF AA antibody
PDGF AA antibody was raised in rabbit using highly pure recombinant human PDGF-AA as the immunogen.GAD65 antibody
The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.
Chlamydia trachomatis antibody
Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis LPS as the immunogen.Purity:>90% By Immunoelectrophoresis Using Agarose.GOT2 antibody
GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAAnnexin A5 antibody
The Annexin A5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of annexin, a protein involved in various cellular processes such as apoptosis and inflammation. This antibody specifically binds to annexin, allowing researchers to study its role in different biological systems.
FGFR1OP antibody
FGFR1OP antibody was raised using the N terminal of FGFR1OP corresponding to a region with amino acids FLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEC6ORF173 antibody
C6ORF173 antibody was raised using the N terminal Of C6Orf173 corresponding to a region with amino acids ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVβ Actin antibody
beta Actin antibody was raised in Mouse using synthetic peptide corresponding to amino-terminal residues of human beta-Actin, conjugated to KLH as the immunogen.Glutathione antibody
The Glutathione antibody is a highly specialized growth factor that plays a crucial role in various biological processes. This antibody specifically targets glutathione, a powerful antioxidant and detoxifying agent found in cells. By binding to glutathione, the antibody neutralizes its effects and prevents oxidative damage.PPP4C antibody
The PPP4C antibody is a highly effective inhibitor of protein phosphatase 4C, which plays a crucial role in various cellular processes. This antibody has been extensively used in the field of life sciences for studying the function and regulation of protein kinases. It is particularly useful for investigating the role of PPP4C in signal transduction pathways and cellular signaling cascades. The PPP4C antibody is generated using recombinant allergens and has been proven to be highly specific and sensitive in detecting its target antigen. It can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA). The antibody is available in polyclonal form and can be conjugated with alkaline phosphatase for enhanced detection. With its synthetic peptide mimics and recombinant antigen, the PPP4C antibody provides researchers with a powerful tool to explore the intricate mechanisms underlying cellular processes.PIK3CB antibody
PIK3CB antibody was raised using the C terminal of PIK3CB corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
hnRNP A1 Antibody
The hnRNP A1 Antibody is a highly specialized Monoclonal Antibody that is widely used in the field of Life Sciences. It plays a crucial role in various cellular processes, including RNA metabolism and regulation. This antibody specifically targets hnRNP A1, a protein involved in mRNA splicing and transport.Calpain 4 antibody
Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLPPARG antibody
The PPARG antibody is a powerful tool used in life sciences research. It specifically targets the peroxisome proliferator-activated receptor gamma (PPARG), a protein involved in various cellular processes. This antibody has been shown to inhibit the activity of cyclin D2 and cyclin D1/CDK4 complexes, leading to cell cycle arrest and induced apoptosis.Fibronectin antibody
The Fibronectin antibody is a polyclonal antibody that specifically targets fibronectin, a glycoprotein involved in cell adhesion and migration. This antibody is widely used in life sciences research to study the role of fibronectin in various biological processes. It can be used to detect and quantify fibronectin levels in different samples, such as tissues or cell cultures. The Fibronectin antibody has also been shown to have potential therapeutic applications, particularly in cancer treatment. Studies have demonstrated its ability to inhibit tumor growth by blocking the interaction between fibronectin and its receptor on cancer cells. Additionally, this antibody has been used in combination with other drugs, such as sorafenib, to enhance their anti-cancer effects. Whether you are conducting research or developing new therapies, the Fibronectin antibody is an essential tool for studying fibronectin biology and its potential applications in various fields of medicine.
TBC1D10A antibody
TBC1D10A antibody was raised in rabbit using the C terminal of TBC1D10A as the immunogenAnti-Müllerian hormone antibody
The Anti-Müllerian hormone antibody is a monoclonal antibody that specifically targets and binds to Anti-Müllerian hormone (AMH). This antibody is widely used in the field of Life Sciences for various research applications. It has been extensively studied and proven to be highly specific and sensitive in detecting AMH levels in human serum samples.STXBP1 antibody
STXBP1 antibody was raised in rabbit using the middle region of STXBP1 as the immunogen
