Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
SIRT1 antibody
SIRT1 antibody was raised in Mouse using a purified recombinant fragment of human SIRT1 expressed in E. coli as the immunogen.Mouse Brain antibody (FITC)
Mouse brain antibody (FITC) was raised in rabbit using brain tissue from Balb/c mice as the immunogen.HDAC1 antibody
The HDAC1 antibody is a highly specialized antibody that is used for various research purposes. It is commonly used in studies involving human serum, electrode, casein, and inhibitory factors. This antibody specifically targets the HDAC1 protein, which is an important enzyme involved in gene regulation. The HDAC1 antibody can be used in both monoclonal and polyclonal forms, depending on the specific research needs. It is a glycoprotein that binds to the HDAC1 protein with high affinity, allowing for accurate detection and analysis. Researchers can use this antibody to study various aspects of gene expression, including messenger RNA levels and oncostatin signaling pathways. The HDAC1 antibody is produced using advanced techniques that ensure high specificity and sensitivity. It contains primary amino acids and cysteine disulfide bonds that contribute to its stability and effectiveness. Whether you are studying gene regulation or conducting experiments in molecular biology, the HDAC1 antibody is an essential tool for your research endeavors.Myogenin antibody
The Myogenin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the alpha-fetoprotein, which is a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be highly effective in binding to the alpha-fetoprotein, making it an essential tool for researchers studying its function and potential therapeutic applications.beta Catenin antibody
The beta Catenin antibody is a growth factor that belongs to the class of antibodies. It acts as an inhibitor, blocking the action of other antibodies and chemokines. In the field of Life Sciences, this monoclonal antibody is widely used as a test compound for various experiments. It specifically targets beta catenin, a nuclear protein involved in cell signaling and adhesion. This antibody has a neutralizing effect on beta catenin, preventing its interaction with other proteins and inhibiting downstream signaling pathways. Additionally, it has been shown to inhibit endothelial growth and interfere with interferon-gamma (IFN-gamma) signaling. The beta Catenin antibody is an essential tool for researchers in the field of Life Sciences looking to study and manipulate cellular processes involving beta catenin.GLUD1 antibody
GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGERLidocaine antibody
Lidocaine antibody was raised in mouse using lidocaine conjugated to KLH as the immunogen.GAPDH antibody
GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCANXA11 antibody
The ANXA11 antibody is a monoclonal antibody that specifically targets vitronectin, a protein involved in cell adhesion and migration. It has been widely used in life sciences research to study the interaction between vitronectin and various growth factors, chemokines, and other molecules. This antibody can be used for applications such as immunohistochemistry, immunofluorescence, and Western blotting to detect the presence of vitronectin in different tissues or cell types. Additionally, the ANXA11 antibody has shown promising results in targeting antigens like epidermal growth factor (EGF), anti-mesothelin antibodies, glucagon, and cetuximab. Its specificity and high affinity make it a valuable tool for researchers in the field of molecular biology and cellular signaling.TRAPPC4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.
DPPA2 antibody
DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLOXSM antibody
OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
CD45 antibody
CD45 antibody was raised in mouse using recombinant human CD45 (1029-1249aa) purified from E. coli as the immunogen.
Lidocaine antibody
Lidocaine antibody was raised in mouse using lidocaine conjugated to KLH as the immunogen.TSKS antibody
TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKKPHF10 antibody
PHF10 antibody was raised using the middle region of PHF10 corresponding to a region with amino acids PELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSADH4 antibody
ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVCD45RA antibody
The CD45RA antibody is a monoclonal antibody that targets the CD45RA protein, which is expressed on certain immune cells. It has been shown to be effective in inhibiting the growth of Corynebacterium glutamicum, a bacterium commonly used in the production of amino acids. The CD45RA antibody can also block the activity of enzymes involved in collagen degradation, leading to potential applications in the field of regenerative medicine and tissue engineering. Additionally, this antibody has been used in Life Sciences research to study various cellular processes, including substrate sirna delivery, modulation of β-catenin signaling, and phosphorylcholine metabolism. Its versatility makes it a valuable tool for scientists studying immune responses, growth factors, sugar phosphotransferase activity, and even certain pathogens like Helicobacter pylori.Insulin antibody
Insulin antibody is a highly specialized antibody that plays a crucial role in regulating glucose metabolism. It is cytotoxic and can neutralize the effects of insulin by binding to it. This antibody has been widely used in research and clinical settings to study various aspects of insulin function.AKTIP antibody
AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
FTCD antibody
FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKPIK3R2 antibody
The PIK3R2 antibody is a highly specialized antibody that belongs to the category of polyclonal antibodies. It is used in the field of life sciences to study various aspects related to hyperammonemia and antibody-drug interactions. This antibody specifically targets the PIK3R2 protein, which plays a crucial role in hormone peptide signaling pathways.Cyclin D1 antibody
The Cyclin D1 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to Cyclin D1, an important protein involved in cell cycle regulation. It is available as both monoclonal and polyclonal antibodies, offering researchers a variety of options for their experiments.STMN1 antibody
The STMN1 antibody is a monoclonal antibody that targets the growth factor Stathmin 1 (STMN1). It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.SMAD6 antibody
SMAD6 antibody was raised in Mouse using a purified recombinant fragment of human SMAD6 expressed in E. coli as the immunogen.
FKBP5 antibody
FKBP5 antibody was raised using the C terminal of FKBP5 corresponding to a region with amino acids CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEMAP1LC3A antibody
MAP1LC3A antibody was raised using the N terminal of MAP1LC3A corresponding to a region with amino acids MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPV
ATF2 antibody
The ATF2 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Monoclonal Antibodies and is widely used for various applications. This antibody specifically targets ATF2, a transcription factor that plays a crucial role in regulating gene expression.
SNCA antibody
The SNCA antibody is a monoclonal antibody that specifically targets the chemokine receptor on virus surface antigens. It has been shown to interfere with the binding of interferons to these receptors, thereby inhibiting viral replication. The SNCA antibody has been extensively studied using mass spectrometric methods and has been found to have neutralizing properties against a wide range of viruses. In addition, it has been shown to activate fibrinogen in human serum, leading to an anticoagulant effect. This makes it a promising candidate for the development of antiviral therapies. With its high specificity and potent activity, the SNCA antibody is a valuable tool in life sciences research and has the potential to revolutionize the field of antiviral treatment.NK1.1 antibody
The NK1.1 antibody is a reactive chemokine that plays a crucial role in various biological processes. It acts as a reversible phosphorylation regulator for protein tyrosine kinases, which are essential for signal transduction in Life Sciences. This antibody is specifically designed to target and bind to the NK1.1 antigen, which is activated by epidermal growth factor, interferon, and mitogen-activated protein signaling pathways.USP10 antibody
The USP10 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the necrosis factor-related apoptosis-inducing protein, USP10. This autoantibody has been extensively studied and proven to be effective in various applications.BTK antibody
The BTK antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and inhibits Bruton's tyrosine kinase (BTK), an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in blocking BTK activity, making it a valuable tool for researchers studying signal transduction pathways and immune system function.HIP1 antibody
The HIP1 antibody is a highly specialized reagent used in life sciences research. It is a polyclonal antibody that specifically targets hematopoietic and gastrointestinal stromal proteins. This antibody has the ability to bind to DNA double-strand breaks, making it an invaluable tool for studying DNA repair mechanisms. The HIP1 antibody can be used in various applications, including immunohistochemical staining and protein interaction studies. Researchers can use this antibody as a test compound to evaluate the efficacy of potential inhibitors or affinity ligands. With its high specificity and versatility, the HIP1 antibody is an essential tool for scientists working in the field of molecular biology and genetics.
TGFBR3 antibody
The TGFBR3 antibody is a biomolecule that belongs to the class of antibodies. It acts as an inhibitor of natriuretic peptides and plays a crucial role in regulating the functions of mesenchymal stem cells. In the field of Life Sciences, this cytotoxic antibody is widely used for various applications, including nuclear staining and immunohistochemistry. Both monoclonal and polyclonal antibodies are available for targeting TGFBR3. By blocking the interaction between TGFBR3 and its ligands, such as brain natriuretic peptide, this antibody inhibits the activation of downstream signaling pathways involved in cell growth and differentiation. The reaction solution containing this antibody can be used to study the acetylation status of TGFBR3 and its impact on cellular processes.RPS5 antibody
The RPS5 antibody is a test substance used in Life Sciences research. It acts as an inhibitor of ribosomal protein synthesis, making it a valuable tool for studying the role of specific proteins in cellular processes. This polyclonal antibody can be used to detect and quantify the presence of RPS5 in various samples, such as cells or tissues. By inhibiting the function of RPS5, researchers can gain insights into its role as a biomarker or potential therapeutic target. The RPS5 antibody can be used in conjunction with other substances, such as calcium or liposomes, to further enhance its inhibitory effects. With its high specificity and sensitivity, this antibody is an essential tool for scientists working in the field of molecular biology and drug discovery.PDLIM2 antibody
The PDLIM2 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. This antibody is specifically designed to target and bind to the PDLIM2 protein, which is an important regulator of cell growth and survival. By binding to PDLIM2, this antibody can effectively block its activity, leading to a disruption in the signaling pathways associated with cell growth and proliferation.
Morphine + Oxycodone antibody
Morphine/Oxycodone antibody was raised in mouse using Oxycodone-BSA as the immunogen.AFP antibody
The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) in human serum. It can be used in various applications, including research in Life Sciences and diagnostics. This antibody binds to AFP, a glycoprotein that is normally produced by the liver during fetal development but can also be present in certain types of cancer, such as hepatocellular carcinoma and germ cell tumors.ANP32B antibody
ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE
Lymphotoxin alpha antibody
Lymphotoxin alpha antibody is a highly specialized medicament used in Life Sciences research. It is an inhibitor that targets adeno-associated virus and plays a crucial role in pluripotent stem cells. This antibody has been extensively used in assays to study the effects of test compounds on interleukin production. Lymphotoxin alpha antibody possesses high affinity for its ligands and has been employed in the isolation of autoantibodies and extracellular markers. Its unique properties make it an indispensable tool for researchers studying various biological processes, including those related to the retina.TUBA1C antibody
The TUBA1C antibody is a growth factor that has been extensively studied in the field of Life Sciences. It has shown promising results as a potential multidrug and interferon therapy. This antibody has demonstrated the ability to inhibit the effects of ketamine and vasoactive intestinal peptide, both of which are involved in various physiological processes. Additionally, it has been found to have neutralizing properties against epidermal growth factor and collagen, making it a valuable tool in research and therapeutic applications. The TUBA1C antibody is available as a high-quality monoclonal antibody that has been tested for its efficacy and specificity. It can be used in various experimental techniques, including low-molecular-weight electrode assays and immunohistochemistry. Researchers and scientists can rely on this antibody to provide accurate and reliable results in their studies.COPS7A antibody
COPS7A antibody was raised using a synthetic peptide corresponding to a region with amino acids NLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLSOX5 antibody
The SOX5 antibody is a monoclonal antibody that targets the catechol-O-methyltransferase (COMT) enzyme. It is widely used in Life Sciences research as a biomolecule for various applications. This antibody specifically recognizes and binds to the activated form of COMT, inhibiting its enzymatic activity. By neutralizing COMT, the SOX5 antibody modulates dopamine levels, which plays a crucial role in several physiological processes.
GABA A Receptor α 1 antibody
GABA A Receptor alpha-1 antibody was raised in mouse using purified GABA/benzodiazepine receptor from bovine cortex as the immunogen.Keratin 18 antibody
The Keratin 18 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic and neutralizing properties. It is commonly used in Life Sciences research to study the role of keratin 18 in various cellular processes. This antibody specifically targets keratin 18, a type of intermediate filament protein found in epithelial cells.MKS1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It effectively treats tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
HIV1 p24 antibody
HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.P2RX7 antibody
P2RX7 antibody was raised using the middle region of P2RX7 corresponding to a region with amino acids LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSPFERMT1 antibody
FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINHTRA2/Omi antibody
HtrA2/Omi antibody was raised in mouse using recombinant human HtrA2/Omi (134-458aa) purified from E. Coli as the immunogen.
