Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SULT1C2 antibody
SULT1C2 antibody was raised using the C terminal of SULT1C2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMELKLHDC2 antibody
KLHDC2 antibody was raised using the N terminal of KLHDC2 corresponding to a region with amino acids VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDVFBXW11 antibody
FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPCdc2 antibody
Cdc2 antibody was raised in Mouse using a purified recombinant fragment of Cdc2 expressed in E. coli as the immunogen.TRIM55 antibody
TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQNorovirus G2 antibody
The Norovirus G2 antibody is a monoclonal antibody that has neutralizing properties against the amyloid protein. It is widely used in Life Sciences research to study the mechanisms of neurodegenerative diseases. This antibody specifically targets and binds to the amyloid protein, preventing its aggregation and deposition in the brain. By inhibiting the formation of amyloid plaques, this antibody has shown potential neuroprotective effects and may help in the development of therapies for Alzheimer's disease and other related disorders. Additionally, this antibody has been found to have activated phosphatase activity, which further contributes to its neuroprotective properties. With its high specificity and affinity for the target, the Norovirus G2 antibody is an invaluable tool for researchers studying amyloid-related diseases.PPM1B antibody
The PPM1B antibody is a potent inhibitor that targets the protein phosphatase family. It has been shown to effectively inhibit adipose tissue growth and catechol-o-methyltransferase activity, making it a valuable tool in obesity research. This monoclonal antibody can be used in various nuclear assays to study its effects on cell signaling pathways and gene expression. Additionally, the PPM1B antibody has demonstrated cytotoxic properties against dopamine-producing cells, which may have implications for the treatment of certain neurological disorders. Its specificity for the circumsporozoite protein also makes it a promising candidate for the development of monoclonal antibodies against malaria. Furthermore, this antibody has been explored as a potential vasoactive intestinal peptide family kinase inhibitor, highlighting its versatility in different research areas.DHX58 antibody
DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM
Cryptosporidium Antibody
Cryptosporidium Antibody is a highly effective monoclonal antibody that is used in bioassays and immunoassays for the detection of Cryptosporidium, a parasitic protozoan that causes gastrointestinal infections. This antibody specifically targets the surface glycoprotein of Cryptosporidium and forms an antigen-antibody complex upon binding. The detection of this complex can be done using various techniques, including electrochemical impedance spectroscopy and microparticle-based assays.IL34 antibody
IL34 antibody was raised in Mouse using a purified recombinant fragment of human IL34 expressed in E. coli as the immunogen.FAM84B antibody
The FAM84B antibody is a powerful tool used in various assays and research studies in the field of Life Sciences. It is a Monoclonal Antibody that specifically targets FAM84B, a protein involved in multiple cellular processes. The antibody has been extensively tested and validated for its high specificity and sensitivity.SETDB1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.TIRAP antibody
The TIRAP antibody is a growth factor that is widely used in the field of Life Sciences. It plays a crucial role in endothelial growth and has been found to regulate the production of interleukin-6 (IL-6), a key cytokine involved in inflammation and immune response. The TIRAP antibody is particularly effective in adipose tissue, where it promotes lipase activity and helps regulate lipid metabolism.BCHE antibody
The BCHE antibody is a cation that specifically targets human serum albumin. It is widely used in the field of Life Sciences for various applications such as hybridization and immunoassays. This monoclonal antibody has a high affinity for serum albumin, making it an excellent tool for detecting and quantifying this protein in biological samples. Additionally, the BCHE antibody has been shown to have neutralizing properties against certain proteins, including epidermal growth factor (EGF-like) molecules. Its ability to bind to albumin and other target proteins has been confirmed through molecular docking studies. With its specificity and versatility, the BCHE antibody is a valuable asset in research and diagnostic settings.MGC45491 antibody
MGC45491 antibody was raised using the middle region of Mgc45491 corresponding to a region with amino acids CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPLIQCD antibody
IQCD antibody was raised using the N terminal of IQCD corresponding to a region with amino acids ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKRL1CAM antibody
The L1CAM antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is produced by hybridoma cells and is designed to specifically target L1 cell adhesion molecule (L1CAM). This antibody plays a crucial role in various biological processes, including cell migration, adhesion, and differentiation.GPRC5A antibody
The GPRC5A antibody is a monoclonal antibody widely used in Life Sciences research. It is specifically designed to target GPRC5A, a protein that plays a crucial role in various cellular processes. This antibody has been shown to have neutralizing effects on GPRC5A, making it an excellent tool for studying the function and regulation of this protein.SIGLEC9 antibody
The SIGLEC9 antibody is a highly specialized monoclonal antibody that targets and inhibits the growth factor protein known as VEGF (vascular endothelial growth factor). This antibody has antiangiogenic properties, meaning it prevents the formation of new blood vessels. By blocking VEGF, the SIGLEC9 antibody hinders the growth and spread of tumors.
Mouse anti Human IgG (Fc Specific) antibody
Mouse anti Human IgG (Fc Specific) antibody was raised in Mouse using purified fusion protein with human IgG(Fc Specific) tag as the immunogen.Interdigitating Cell antibody (Rat)
Interdigitating cell antibody was raised in mouse using rat peritoneal macrophages as the immunogen.C14ORF172 antibody
C14ORF172 antibody was raised using the N terminal Of C14Orf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLILMAN1 antibody
LMAN1 antibody was raised using the N terminal of LMAN1 corresponding to a region with amino acids DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSPurity:Min. 95%Patched antibody
The Patched antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It acts as an agent and/or biocompatible polymer, which can be activated through disulfide bond formation. The nucleophilic linker group allows for the attachment of various molecules or compounds for targeted delivery. This antibody specifically targets the anti-ICOS antibodies, a human protein involved in immune regulation. The Patched antibody has high bioavailability and can be used to develop anti-idiotypic antibodies or reactive monoclonal antibodies. Additionally, it has shown affinity towards annexin A2, further expanding its potential applications in research and therapeutic settings.
RSV Antibody
The RSV Antibody is a powerful serine protease inhibitor that belongs to the family of kinase inhibitors. This antibody is designed to target and neutralize specific proteins involved in respiratory syncytial virus (RSV) infection. By blocking the activity of these proteins, the RSV Antibody prevents the virus from entering and replicating within host cells.Pf HRP2 antibody
Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.
IARS antibody
IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
DGKA antibody
The DGKA antibody is a specific antibody that targets the epidermal growth factor (EGF) and has applications in Life Sciences. It is a monoclonal antibody that can neutralize the effects of TNF-α, which is involved in inflammation and immune response. The DGKA antibody has been shown to inhibit the activity of collagen, TGF-beta, and other EGF-like proteins, which play key roles in cell growth and tissue repair. Additionally, it can bind to fibronectin and block its interactions with other molecules. This antibody is highly effective in blocking the activity of autoantibodies and growth factors, making it a valuable tool for research in various fields such as immunology, oncology, and regenerative medicine. With its ability to target activated chemokines, the DGKA antibody holds great potential for therapeutic applications as well.CD106 antibody
The CD106 antibody is a cytotoxic monoclonal antibody that targets the CD106 protein, also known as vascular cell adhesion molecule 1 (VCAM-1). This antibody is widely used in Life Sciences research for its neutralizing properties against CD106, which plays a crucial role in inflammatory processes and immune responses. The CD106 antibody specifically binds to CD106 expressed on endothelial cells, inhibiting the interaction with leukocytes and preventing their adhesion to the vessel wall. This inhibition of leukocyte adhesion can have therapeutic implications in various diseases, including autoimmune disorders and cardiovascular conditions. Additionally, the CD106 antibody has been shown to disrupt actin filaments and interfere with growth factor signaling pathways, such as insulin-like growth factor-1 receptor (IGF-1R) and acidic fibroblast growth factor (FGF). Its versatility makes it a valuable tool for researchers studying cell adhesion mechanisms, inflammation, and angiogenesis.IgM antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has shown its high efficacy through the use of advanced techniques like the patch-clamp technique on human erythrocytes. Its active form undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.RGMA antibody
The RGMA antibody is a highly specialized monoclonal antibody that has been developed for use in various research and clinical applications. This antibody specifically targets the RGMA protein, which plays a crucial role in neuronal development and regeneration. By binding to RGMA, this antibody activates signaling pathways that promote neurite outgrowth and axonal guidance.DLAT antibody
DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAMEF2A antibody
The MEF2A antibody is a highly specialized antibody complex used in Life Sciences research. It is a polyclonal antibody that has been specifically designed to target and bind to the MEF2A protein, which is a nuclear receptor involved in gene expression regulation. This antibody has been extensively tested and validated for its ability to detect and neutralize MEF2A, making it an essential tool for studying the function of this protein.HADHB antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through experiments using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
Goat anti Pig IgG (H + L) (FITC)
Goat anti-pig IgG (H + L) (FITC) was raised in goat using porcine IgG, (H & L) as the immunogen.EXOC3 antibody
EXOC3 antibody was raised using the middle region of EXOC3 corresponding to a region with amino acids LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFGPRC5B antibody
The GPRC5B antibody is a highly specialized protease that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and interacts with the GPRC5B antigen, which is involved in various biological processes. This antibody has been extensively studied for its potential applications in antiviral therapies, high-flux extracellular chemotherapy, and as an inhibitor in certain disease pathways. The GPRC5B antibody is widely recognized for its exceptional specificity and sensitivity, making it an invaluable tool for researchers and scientists working in the field of antibodies and autoantibodies.
AHSG antibody
The AHSG antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize alpha-fetoprotein (AFP), a protein complex that plays a crucial role in various physiological processes. The AHSG antibody specifically binds to AFP and inhibits its activity, making it an invaluable tool for studying the function of this protein.PGBD3 antibody
PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSLC13A3 antibody
SLC13A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFIL18 antibody
The IL18 antibody is a reactive antibody that targets the glial fibrillary acidic protein (GFAP), which is expressed in activated glial cells. This antibody has been widely used in life sciences research to study the role of GFAP in various cellular processes. It has also been used as a diagnostic tool for detecting GFAP expression in tissues, such as brain sections with amyloid plaques. The IL18 antibody is available as a polyclonal antibody and can be used in various applications, including immunohistochemistry, western blotting, and ELISA. It offers high specificity and sensitivity, making it an ideal choice for researchers studying GFAP-related pathways or diseases.mGLUR2 antibody
The mGLUR2 antibody is a monoclonal antibody that specifically targets the metabotropic glutamate receptor 2 (mGLUR2). This receptor plays a crucial role in various physiological and pathological processes, including neuronal signaling, synaptic plasticity, and neurodegenerative diseases. The mGLUR2 antibody binds to the receptor and modulates its activity, leading to changes in cellular responses.A1CF antibody
A1CF antibody was raised using the N terminal of A1CF corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPDLIM2 antibody
The PDLIM2 antibody is a highly specialized monoclonal antibody that targets the phosphatase PDLIM2. It has been extensively studied for its therapeutic potential in various fields of medicine, including ketamine-induced neurotoxicity and lipoprotein lipase activation. This antibody is widely used in Life Sciences research to study the role of PDLIM2 in various cellular processes, such as epidermal growth factor signaling, histidine metabolism, growth factor regulation, chemokine production, fibrinogen binding, and TGF-beta signaling. The cytotoxic properties of this antibody make it a valuable tool for investigating the functions of PDLIM2 in different biological contexts.
