Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Chlamydia trachomatis antibody (FITC)
Chlamydia trachomatis antibody (FITC) was raised in goat using purified MOMP from strain L2 as the immunogen.Donkey anti Goat IgG (H + L) (FITC)
Donkey anti-goat IgG (H + L) (FITC) was raised in donkey using goat IgG (H & L) as the immunogen.Caspase 1 antibody
The Caspase 1 antibody is a highly effective globulin that acts as a neutralizing agent against caspase 1. This monoclonal antibody has been specifically developed to target and inhibit the activity of caspase 1, an enzyme involved in inflammatory responses. By binding to caspase 1, this antibody blocks its function and prevents the release of pro-inflammatory cytokines.FAS ligand antibody
The FAS ligand antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the FAS ligand, a protein involved in various cellular processes such as collagen production, dopamine regulation, erythropoietin synthesis, and fibrinogen formation. By binding to the FAS ligand, this antibody effectively inhibits its function and disrupts downstream signaling pathways.p16 antibody
p16 antibody was raised in Mouse using a purified recombinant fragment of P16 expressed in E. coli as the immunogen.PGD antibody
The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.
SOCS3 antibody
The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.
CD66b antibody
The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to
ERK1/2 antibody
The ERK1/2 antibody is a monoclonal antibody that targets the extracellular signal-regulated kinase 1 and 2 (ERK1/2). It plays a crucial role in cell signaling pathways, including those involved in immune response and cell proliferation. This antibody specifically binds to ERK1/2, inhibiting their activity and preventing downstream signaling events.SDS antibody
The SDS antibody is a monoclonal antibody that specifically targets Tumor Necrosis Factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This antibody works by binding to TNF-α and neutralizing its activity, thereby reducing inflammation. Additionally, the SDS antibody has been shown to have specific binding affinity for epidermal growth factor-like proteins, natriuretic peptides, fibronectin, collagen, and autoantibodies. With its high specificity and neutralizing properties, the SDS antibody is a valuable tool in life sciences research for studying the role of TNF-α and other growth factors in various biological processes.CEA antibody
The CEA antibody is a glycoprotein that is commonly found in human serum. It is widely used in Life Sciences research and has shown potential in various applications. The CEA antibody can be activated to bind to specific antigens, making it a valuable tool for the detection and analysis of target molecules. This monoclonal antibody has been extensively studied and has been shown to have cytotoxic effects on cancer cells. Additionally, it has been found to inhibit the growth factor signaling pathways and regulate mitogen-activated protein activity. The CEA antibody is a versatile and powerful tool that can be used in various research fields and holds great promise for future advancements in biomedical research.PSPH antibody
The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.
PPP1R8 antibody
PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYCLIC4 antibody
CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF
Fenitrothion antibody
The Fenitrothion antibody is a powerful tool used in research and diagnostics. It specifically targets the molecule Icos, which plays a crucial role in immune response regulation. This antibody is highly specific and can effectively detect autoantibodies in human serum, making it invaluable in the study of autoimmune disorders. Additionally, it has cytotoxic properties that make it useful for targeted therapy against certain diseases. The Fenitrothion antibody can also be used to detect thrombocytopenia, as well as to study the expression of urokinase plasminogen activator and collagen. Whether you're conducting groundbreaking research or need accurate diagnostic results, this monoclonal antibody is an essential tool in your arsenal.
RORA antibody
RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS
Donkey anti Goat IgG (H + L) (biotin)
Donkey anti-goat IgG (H + L) (biotin) was raised in donkey using goat IgG (H & L) as the immunogen.Ku80 antibody
The Ku80 antibody is a serotonergic antibody that targets the c-myc protein. It is widely used in the Life Sciences field for various applications. This polyclonal antibody is derived from human serum and specifically recognizes the fatty acid-activated nuclear alpha-fetoprotein hormone peptide. The Ku80 antibody can be used in experiments involving immunohistochemistry, Western blotting, and ELISA assays. Its high specificity and affinity make it an ideal tool for detecting and quantifying the target antigen. Whether you're conducting research or developing diagnostic tests, the Ku80 antibody is a valuable asset in your laboratory.LRP antibody (515 kDa)
LRP antibody (515 kDa) was raised in mouse using human LRP/a2MR as the immunogen.Enterobacteriaciae Antibody
Mouse anti-Enterobacteriaciae AntibodyPurity:> 90% By Immunoelectrophoresis Using AgaroseEME1 antibody
EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISPeanut Protein Antibody
The Peanut Protein Antibody is a highly versatile and effective product with a wide range of characteristics and applications. It possesses antiviral properties and acts as a growth factor, making it an essential tool in various research fields. This antibody has been extensively studied for its ability to combat infections caused by Mycoplasma genitalium and its potential for inhibiting hemolysis.SMN1 antibody
SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVMAF antibody
The MAF antibody is a polyclonal antibody used in Life Sciences. It is designed to target specific proteins and molecules, such as helicobacter, botulinum toxin, β-catenin, epidermal growth factor, and more. This antibody has been extensively tested and proven to be effective in various applications, including Western blotting, immunohistochemistry, and ELISA.GTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHCDH2 antibody
The CDH2 antibody is a monoclonal antibody that targets the CDH2 protein expressed in various tissues, including rat liver microsomes. This antibody is widely used in Life Sciences research to study the role of CDH2 in different biological processes. It has been shown to have cholinergic and catecholaminergic properties, affecting neurotransmitter release and signaling pathways. Additionally, the CDH2 antibody has been found to modulate the expression of interleukin-6 and dopamine in rat liver microsomes. Its binding to the CDH2 protein leads to lysis of target cells and inhibition of cellular functions. Researchers also utilize this antibody to detect the presence of CDH2 in samples using techniques like immunofluorescence or Western blotting. The CDH2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs.Apolipoprotein E antibody
The Apolipoprotein E antibody is a polyclonal antibody that specifically targets the colony-stimulating factor (CSF) Apolipoprotein E. This antibody has been shown to have neutralizing effects on the toxic effects of CSF, making it a valuable tool for research in the field of immunology. It has also been shown to inhibit the activity of alpha-fetoprotein and family kinase inhibitor, further highlighting its versatility in various applications. The Apolipoprotein E antibody can be used in immunoassays such as ELISA or Western blotting to detect and quantify the presence of this protein in biological samples. With its high specificity and affinity, this monoclonal antibody is an essential tool for researchers studying the role of Apolipoprotein E in various physiological processes.PR6 antibody
The PR6 antibody is a highly specialized monoclonal antibody with unique characteristics. It has been extensively studied for its hybridization capabilities and its ability to bind to the amino-terminal region of specific proteins. This antibody exhibits high viscosity, making it ideal for use in assays that require increased sensitivity.Neuropilin 1 antibody
The Neuropilin 1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the neuropilin 1 molecule, which plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.CSTF2 antibody
CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAKLHL12 antibody
KLHL12 antibody was raised in Mouse using a purified recombinant fragment of human KLHL12 expressed in E. coli as the immunogen.TGF beta1 Antibody
The TGF beta1 Antibody is a highly specialized antibody that targets the transforming growth factor beta 1 (TGF-β1), a key protein involved in various biological processes. This antibody has been extensively researched and is widely used in Life Sciences for its ability to neutralize the effects of TGF-β1.VWF antibody (HRP)
VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.
Synapsin 1 antibody
The Synapsin 1 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to Synapsin 1, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. This antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA.FAM81A antibody
FAM81A antibody was raised using the N terminal of FAM81A corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTCyclin B1 antibody
The Cyclin B1 antibody is a highly specific monoclonal antibody that targets the virus surface antigen, influenza hemagglutinin. It is widely used in Life Sciences research to study the role of cyclin B1 in cell cycle regulation and cellular processes. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. The Cyclin B1 antibody has been shown to have high affinity and specificity for its target, making it an excellent tool for researchers studying cell division and proliferation. Additionally, this antibody has neutralizing activity against certain strains of influenza virus, making it a potential therapeutic candidate for antiviral treatments. With its exceptional performance and versatility, the Cyclin B1 antibody is a valuable asset in any laboratory setting.UBE2I antibody
UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG
p63 antibody
The p63 antibody is a cytotoxic agent that belongs to the class of antibodies used in Life Sciences. It is activated upon binding to its target antigen and has been shown to be effective in various research applications. The p63 antibody can be used for immunohistochemistry studies to detect the presence and localization of specific proteins or markers in tissue samples. It can also be used as a tool for protein analysis, such as Western blotting or ELISA assays. The p63 antibody has been used in studies involving alpha-fetoprotein, sclerostin, and phosphatase, among others. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific experimental needs. With its high specificity and sensitivity, the p63 antibody is a valuable tool for researchers in the field of Life Sciences.RAP1 antibody
The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.
CXCL10 antibody
The CXCL10 antibody is a highly specialized antibody that has a wide range of applications in the field of Life Sciences. It has been extensively studied for its inhibitory and neutralizing effects on insulin-like growth factor-I (IGF-I) and CXCL13, which are important factors in various biological processes. This antibody has been shown to have anti-angiogenic and anti-fibrotic effects, making it a potential therapeutic option for conditions such as cancer and fibrosis. Additionally, the CXCL10 antibody has been found to have a chemotactic effect on mesenchymal stem cells, further highlighting its versatility in different research areas. This antibody is available as a polyclonal antibody and can be used as a control antibody in various experimental settings.APOA1BP antibody
The APOA1BP antibody is a highly specific monoclonal antibody that targets the phosphatase enzyme. It has been extensively studied for its ability to inhibit epidermal growth factor signaling pathways. This antibody is widely used in research and diagnostic applications, including the detection of various proteins such as insulin, alpha-fetoprotein, and dopamine. The APOA1BP antibody can be used in a variety of assays, including tyrosine phosphorylation assays and neutralizing assays for growth factors. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for studying cellular signaling pathways and protein interactions.MMP14 antibody
The MMP14 antibody is a powerful tool in the field of molecular biology and research. It is an insulin-like growth factor-binding protein that plays a crucial role in various cellular processes. This antibody specifically targets and binds to MMP14, also known as matrix metalloproteinase 14, which is involved in the degradation of extracellular matrix components.
