Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SMS antibody
The SMS antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a wide range of applications, including the study of fibrinogen and annexin proteins. This antibody is commonly used in experiments involving electrodes and has been proven to be effective in detecting and quantifying cortisol levels. Additionally, the SMS antibody has shown promising results as a family kinase inhibitor, making it a valuable tool for studying dopamine and growth factor signaling pathways. Its specificity and high affinity make it an ideal choice for researchers working with tyrosine antibodies, mcf-7 cells, cephalosporins, and inhibitors. With its versatility and reliability, the SMS antibody is an essential component in various scientific investigations.DNAJA2 antibody
DNAJA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDAZAP1 antibody
DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids QAAPDMSKPPTAQPDFPYGQYGLGSYSPAPPGCGPHFVYSLMVRLSSDVASNAP25 antibody
SNAP25 antibody was raised in mouse using recombinant human SNAP25 (1-206aa) purified from E. coli as the immunogen.TRIM9 antibody
The TRIM9 antibody is a highly specialized polyclonal antibody that targets TNF-α, a key cytokine involved in inflammation and immune response. This antibody is also available in a monoclonal form for specific targeting of TNF-α. It has been shown to have neutralizing properties, effectively blocking the activity of TNF-α and preventing its binding to its receptors.
KLK-BL4 antibody
KLK-BL4 antibody was raised using the C terminal Of Klkbl4 corresponding to a region with amino acids EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI
SFRP5 antibody
SFRP5 antibody was raised in rabbit using residues 25-38 [APARCEEYDYYGWQ] of human SFRP5 as the immunogen.Purity:Min. 95%CD28 antibody (PE)
CD28 antibody (PE) was raised in mouse using chicken CD28 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molMAGEL2 antibody
MAGEL2 antibody was raised in rabbit using the C terminal of MAGEL2 as the immunogenPurity:Min. 95%CD49b antibody
CD49b antibody was raised in mouse using human CD49b as the immunogen.Purity:Min. 95%Molecular weight:0 g/molIL22R alpha 1 antibody
IL22R alpha 1 antibody was raised using the middle region of IL22RA1 corresponding to a region with amino acids DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWEPurity:Min. 95%CD44 antibody (biotin)
CD44 antibody (biotin) was raised in rat using murine CD44 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCHIA antibody
CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
Purity:Min. 95%ZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the middle region of ZKSCAN1 as the immunogen
Purity:Min. 95%ApoH antibody
ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADPurity:Min. 95%CD107b antibody
CD107b antibody was raised in mouse using human CD107b/LAMP-2Purity:Min. 95%Molecular weight:0 g/molFAM3C antibody
FAM3C antibody was raised using the C terminal of FAM3C corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Purity:Min. 95%FLJ33706 antibody
FLJ33706 antibody was raised in rabbit using the C terminal of FLJ33706 as the immunogen
Purity:Min. 95%IL1RAPL2 antibody
IL1RAPL2 antibody was raised using the middle region of IL1RAPL2 corresponding to a region with amino acids ADLANYTCHVENRNGRKHASVLLRKKDLIYKIELAGGLGAIFLLLVLLVVPurity:Min. 95%CD11a antibody (Azide Free)
CD11a antibody (Azide free) was raised in mouse using human CD11a (LFA-1a) as the immunogen.CD147 antibody
The CD147 antibody is a glycoprotein that is used to detect the presence of antiphospholipid antibodies in human serum. It is an essential tool for researchers studying the role of these antibodies in various diseases and conditions. This antibody specifically targets CD147, a cell surface receptor that plays a crucial role in cellular processes such as growth factor signaling and immune response modulation. The CD147 antibody can be used in various applications, including immunohistochemistry, flow cytometry, and Western blotting. Its high specificity and neutralizing activity make it an ideal choice for both research and diagnostic purposes. Whether you are studying autoimmune disorders or developing therapeutic interventions, the CD147 antibody is an invaluable tool that will help you gain valuable insights into the mechanisms underlying these conditions.Purity:Min. 95%Filamin A antibody
The Filamin A antibody is a highly specialized product in the field of Life Sciences. It is used for various applications, including electrochemical impedance spectroscopy and molecular docking. This antibody enables ultrasensitive detection of specific molecules by binding to them and facilitating their measurement through electrochemical impedance. It can be used in research settings, as well as in clinical diagnostics.Purity:Min. 95%CD4a antibody (PE)
CD4a antibody (PE) was raised in mouse using CD4a as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD19 antibody (FITC)
CD19 antibody (FITC) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD11a antibody (PE-CY7)
CD11a antibody (PE-CY7) was raised in rat using murine CD11a (LFA-1a) as the immunogen.Purity:Min. 95%Molecular weight:0 g/molPRODH2 antibody
PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIRIL15 antibody
IL15 antibody was raised in rabbit using highly pure recombinant human IL-15 as the immunogen.Purity:Min. 95%CD3e antibody (PE)
CD3e antibody (PE) was raised in mouse using porcine CD3e as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD22 antibody (PE)
CD22 antibody (PE) was raised in rat using CD22 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCaplacizumab
CAS:A monoclonal antibody fragment (nanobody) that binds to von Willebrand factor (vWF), thereby inhibiting platelet adhesion.CD3e antibody (biotin)
CD3e antibody (biotin) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.Purity:Min. 95%Molecular weight:0 g/molDengue Virus Type 4 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 4 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Growth Hormone 2 antibody
Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCRnf183 antibody
Rnf183 antibody was raised in rabbit using the N terminal of Rnf183 as the immunogenPurity:Min. 95%LBP antibody
LBP antibody was raised using the middle region of LBP corresponding to a region with amino acids LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKVPurity:Min. 95%CCK antibody
CCK antibody was raised using the middle region of CCK corresponding to a region with amino acids IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPSPurity:Min. 95%TRIM48 antibody
TRIM48 antibody was raised in rabbit using the C terminal of TRIM48 as the immunogenPurity:Min. 95%RanBP3 antibody
RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHPurity:Min. 95%Arnt antibody
Arnt antibody was raised in rabbit using the C terminal of Arnt as the immunogen
Purity:Min. 95%ZNF565 antibody
ZNF565 antibody was raised in rabbit using the middle region of ZNF565 as the immunogen
Purity:Min. 95%CD25 antibody (FITC)
CD25 antibody (FITC) was raised in rat using alpha chain IL-2 receptor as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD11a antibody (PE)
CD11a antibody (FITC) was raised in mouse using human CD11a (LFA-1a) as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD31 antibody (PE-CY7)
CD31 antibody (PE-CY7) was raised in Rat using mouse leukocyte cell line 32D as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molALDH6A1 antibody
ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWPurity:Min. 95%CD4a antibody (biotin)
CD4a antibody (biotin) was raised in mouse using CD4a as the immunogen.Purity:Min. 95%Molecular weight:0 g/molC1orf83 antibody
C1orf83 antibody was raised in rabbit using the N terminal of C1ORF83 as the immunogen
Purity:Min. 95%CD24 antibody (FITC)
CD24 antibody (FITC) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD152 antibody (Azide Free)
CD152 antibody (Azide free) was raised in hamster using keat-killed Staphylococcus A bacteria coated with murine CTLA-4/human IgG1 fusion protein as the immunogen.ADCYAP1R1 antibody
ADCYAP1R1 antibody was raised in rabbit using the C terminal of ADCYAP1R1 as the immunogenPurity:Min. 95%USP3 antibody
USP3 antibody was raised in rabbit using the middle region of USP3 as the immunogenPurity:Min. 95%Arsg antibody
Arsg antibody was raised in rabbit using the C terminal of Arsg as the immunogenPurity:Min. 95%EPOr antibody
EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLPurity:Min. 95%CD45.2 antibody (PE-CY7)
CD45.2 antibody (Allophycocyanin) was raised in mouse using CD45.2 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molEXT2 antibody
EXT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRWPurity:Min. 95%ICAM1 antibody
ICAM1 antibody was raised in rabbit using highly pure recombinant human ICAM-1 as the immunogen.
Purity:Min. 95%CD25 antibody (Spectral Red)
CD25 antibody (Spectral Red) was raised in rat using alpha chain IL-2 receptor as the immunogen.Purity:Min. 95%Molecular weight:0 g/molDusp19 antibody
Dusp19 antibody was raised in rabbit using the N terminal of Dusp19 as the immunogenPurity:Min. 95%AADACL4 antibody
AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWRPurity:Min. 95%CD152 antibody (PE)
CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCANT1 antibody
CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGPurity:Min. 95%CD44 antibody (PE)
CD44 antibody (PE) was raised in rat using murine CD44 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molSlc25a27 antibody
Slc25a27 antibody was raised in rabbit using the C terminal of Slc25a27 as the immunogen
Purity:Min. 95%Calsequestrin antibody
Calsequestrin antibody was raised in rabbit using purified canine cardiac calsequestrin as the immunogen.Purity:Min. 95%CD38 antibody (FITC)
CD38 antibody (FITC) was raised in rat using CD38 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCytokeratin 18 antibody
The Cytokeratin 18 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets activated protein C and has been extensively used in research to study various biological processes. It is commonly used to detect and quantify cytokeratin 18, which is an intermediate filament protein found in epithelial cells. The Cytokeratin 18 antibody has also been used to study the role of cytokeratins in diseases such as cancer, where abnormal expression of these proteins can be observed. Additionally, this antibody has shown promising results in the detection of autoantibodies and inhibitors associated with autoimmune disorders. Its high specificity and sensitivity make it an invaluable tool for researchers working in the fields of immunology, pathology, and molecular biology.Purity:Min. 95%UBE3A antibody
UBE3A antibody was raised using the N terminal Of Ube3A corresponding to a region with amino acids SLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPPurity:Min. 95%OR1S1 antibody
OR1S1 antibody was raised in rabbit using the C terminal of OR1S1 as the immunogenPurity:Min. 95%CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD8a antibody (Azide Free)
CD8a antibody (Azide free) was raised in rat using murine thymus or spleen as the immunogen.Purity:Min. 95%Molecular weight:0 g/molVASP antibody
The VASP antibody is a polyclonal antibody that specifically targets and binds to the VASP protein. VASP, also known as vasodilator-stimulated phosphoprotein, plays a crucial role in cell signaling pathways and cytoskeletal rearrangement. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.
Purity:Min. 95%IRX6 antibody
IRX6 antibody was raised in rabbit using the N terminal of IRX6 as the immunogenPurity:Min. 95%CD19 antibody (biotin)
CD19 antibody (biotin) was raised in mouse using human CD19 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molNCOR1 antibody
NCOR1 antibody was raised in rabbit using the N terminal of NCOR1 as the immunogen
Purity:Min. 95%CD25 antibody (PE-CY7)
CD25 antibody (PE-CY7) was raised in rat using alpha chain IL-2 receptor as the immunogen.Purity:Min. 95%Molecular weight:0 g/molFGF10 antibody
FGF10 antibody was raised in goat using highly pure recombinant human FGF-10 as the immunogen.Purity:Min. 95%CD45.1 antibody (CY5)
CD45.1 antibody (CY5) was raised in mouse using CD45.1 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD44 antibody (biotin)
CD44 antibody (biotin) was raised in mouse using human CD44 as the immunogenPurity:Min. 95%Molecular weight:0 g/molCD24 antibody (biotin)
CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molSTAT5B antibody
STAT5B antibody was raised in rabbit using the N terminal of STAT5B as the immunogenPurity:Min. 95%KITLG antibody
KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGPurity:Min. 95%Jund antibody
Jund antibody was raised in rabbit using the N terminal of Jund as the immunogenPurity:Min. 95%ZFP42 antibody
ZFP42 antibody was raised in rabbit using the middle region of ZFP42 as the immunogenPurity:Min. 95%E. coli O157 antibody (FITC)
E. coli O157 antibody (FITC) was raised in mouse using 'O' antigen of E. coli serotype O157 as the immunogen.GALNTL1 antibody
GALNTL1 antibody was raised using the N terminal Of Galntl1 corresponding to a region with amino acids LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLPPurity:Min. 95%CD45.2 antibody (PE-CY5.5)
CD45.2 antibody (PE) was raised in mouse using CD45.2 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molListeria antibody
The Listeria antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential applications in various research areas. This antibody specifically targets Listeria, a bacterium known to cause foodborne illnesses.Purity:Min. 95%NRG1 antibody
NRG1 antibody was raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS
Purity:Min. 95%
