Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MIP1 alpha antibody (biotin)
MIP1 alpha antibody (biotin) was raised in rabbit using highly pure recombinant murine MIP-1a as the immunogen.
ANKRD7 antibody
ANKRD7 antibody was raised using the middle region of ANKRD7 corresponding to a region with amino acids SENKSPLIKAVQCQNEDCATILLNFGADPDLRDIRYNTVLHYAVCGQSLSFTO antibody
FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTAOGG1 antibody
The OGG1 antibody is a highly specialized monoclonal antibody that targets the OGG1 protein. This protein is involved in DNA repair and plays a crucial role in maintaining genomic stability. The OGG1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.FKHR antibody
The FKHR antibody is a diagnostic agent used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) and is commonly used as a target molecule in various immunoassays. The FKHR antibody is a monoclonal antibody that binds to fibronectin, an important protein involved in cell adhesion and migration. This antibody can be used to detect and quantify the levels of EGF in biological samples, making it a valuable tool for studying growth factors and their role in cellular processes. Additionally, the FKHR antibody has been shown to have neutralizing properties, which makes it useful for blocking the activity of EGF and investigating its effects on cells. With its high specificity and sensitivity, the FKHR antibody is an essential tool for researchers working in the field of Life Sciences.IL18RAP antibody
IL18RAP antibody was raised using the N terminal of IL18RAP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCKIAA1704 antibody
KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGUBE2T antibody
The UBE2T antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets UBE2T, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.GPR151 antibody
The GPR151 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It targets the p38 mitogen-activated protein phosphatase, which plays a crucial role in various cellular processes such as growth factor signaling and β-catenin activation. This antibody specifically recognizes and binds to the activated form of the p38 MAP phosphatase, allowing for its detection and analysis.
SAA antibody
SAA antibody is a monoclonal antibody that specifically targets serum amyloid A (SAA), a glycoprotein involved in the immune response and inflammation. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. SAA antibody can be used for the detection and quantification of SAA levels, making it a valuable tool in research and diagnostic settings. Additionally, this monoclonal antibody has been used to study the role of SAA in diseases such as cancer, cardiovascular disorders, and autoimmune conditions. Its high specificity and affinity make it an ideal choice for experiments involving SAA, providing accurate and reliable results. With its ability to bind to SAA with precision, this antibody opens up new possibilities for understanding the mechanisms underlying these diseases and developing targeted therapies. Whether you're conducting cutting-edge research or working on diagnostic assays, SAA antibody is an indispensable tool that will help advance your scientific endeavors.
FBXO16 antibody
FBXO16 antibody was raised using the N terminal of FBXO16 corresponding to a region with amino acids CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLANOD1 antibody
The NOD1 antibody is a highly sensitive detection tool used in immunoassays. It belongs to the family of antibodies used in Life Sciences research. This polyclonal antibody is specifically activated against amyloid plaque, making it an ideal tool for studying and detecting this protein in various biological samples. The NOD1 antibody can be utilized in a range of applications, including DNA vaccines, carbon electrode bioassays, and immunoassays targeting amyloid proteins. It is available both as a polyclonal and monoclonal antibody, ensuring flexibility for different experimental needs. With its high specificity and sensitivity, the NOD1 antibody is commonly used for detecting anti-beta amyloid antibodies in human serum or alpha-fetoprotein in various clinical and research settings.
HEATR4 antibody
HEATR4 antibody was raised using the N terminal of HEATR4 corresponding to a region with amino acids VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYNHBsAg antibody (biotin)
HBsAg antibody (biotin) was raised in goat using subtypes ad & ay as the immunogen.BIM antibody
The BIM antibody is a monoclonal antibody that specifically targets c-myc, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of c-myc. It can be used in techniques such as immunohistochemistry, immunofluorescence, and Western blotting to detect the presence of c-myc in different samples.KCTD3 antibody
KCTD3 antibody was raised using the middle region of KCTD3 corresponding to a region with amino acids VNKSEDKDVGGPTEEELLKLLDQCDLSTSRCATPNISPATSVVQHSHLRETyk2 antibody
Tyk2 antibody was raised in Mouse using a purified recombinant fragment of Tyk2 expressed in E. coli as the immunogen.
C13orf30 antibody
C13orf30 antibody was raised using the N terminal of C13orf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY
BTK antibody
BTK antibody was raised in Mouse using a purified recombinant fragment of BTK expressed in E. coli as the immunogen.
HSV1 antibody (FITC)
HSV1 antibody (FITC) was raised in goat using HSV type 1, strain F as the immunogen.IKK alpha/beta antibody (Phospho-Ser176)
Rabbit polyclonal IKK alpha/beta antibody for detection of the Phospho-Ser176 form of the IKK alpha/beta peptide.
FBXL20 antibody
FBXL20 antibody was raised in rabbit using the middle region of FBXL20 as the immunogen
NCOR1 antibody
The NCOR1 antibody is a highly specialized product in the field of Life Sciences. It is a colloidal solution that targets insulin and growth factor receptors. This polyclonal antibody has been extensively tested and proven to effectively bind to tyrosinase, alkaline phosphatases, epidermal growth factor, and anti-ACTH antibodies. With its high specificity and affinity for these targets, the NCOR1 antibody plays a crucial role in various research applications involving insulin signaling pathways and hormone regulation. Whether you are studying the effects of insulin on cell growth or investigating novel therapeutic approaches for diabetes, this Antibody is an essential tool for your experiments. Trust in its reliability and accuracy to deliver consistent results every time.POP5 antibody
POP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGECD62L antibody
CD62L antibody was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.ARHGAP19 antibody
ARHGAP19 antibody was raised in rabbit using the C terminal of ARHGAP19 as the immunogenHSP70 antibody
The HSP70 antibody is a polyclonal antibody that specifically binds to heat shock protein 70 (HSP70). Heat shock proteins are a group of proteins that are produced in response to stress, such as high temperatures or exposure to toxins. HSP70 is involved in various cellular processes, including protein folding, transport, and degradation.14-3-3 sigma antibody
The 14-3-3 sigma antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the 14-3-3 sigma protein, which plays a crucial role in various cellular processes. This antibody can be used to detect and quantify the expression levels of 14-3-3 sigma in different samples, such as cell lysates or tissue extracts.Fibrin Fragment E antibody (HRP)
Fibrin Fragment E antibody (HRP) was raised in sheep using human Fibrin Fragment E purified from plasma lysate of crosslinked fibrin clot as the immunogen.
NOX1 antibody
The NOX1 antibody is a highly specialized polyclonal antibody that targets the oncostatin receptor. It is designed to specifically bind to glial fibrillary acidic protein (GFAP), an antigen expressed in glial cells. This antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence and localization of GFAP in tissues or cell cultures.
C11ORF46 antibody
C11ORF46 antibody was raised using the N terminal Of C11Orf46 corresponding to a region with amino acids SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKKAngiotensinogen antibody
The Angiotensinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize angiotensinogen, a protein that plays a key role in the regulation of blood pressure and fluid balance in the body. This antibody has been extensively studied and proven to be effective in blocking the activation of angiotensinogen, thereby preventing its interaction with other molecules such as atrial natriuretic peptide and albumin.
alpha 1B Glycoprotein antibody
alpha 1B Glycoprotein antibody was raised in Rabbit using Human alpha 1B Glycoprotein antibody as the immunogenGABPA antibody
GABPA antibody was raised in Mouse using a purified recombinant fragment of human GABPA (aa120-190) expressed in E. coli as the immunogen.AKR1C2 antibody
The AKR1C2 antibody is a highly specialized protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown significant potential in research and therapeutic applications.
STK24 antibody
The STK24 antibody is a polyclonal antibody that is highly effective in targeting and neutralizing cytotoxic factors in various biological samples, including pleural fluid, human serum, and tissue culture media. This antibody specifically binds to STK24, a protein kinase involved in the regulation of cell growth and survival. By binding to STK24, this antibody inhibits its activity and prevents the downstream signaling pathways that promote cell proliferation and survival.
GPRASP2 antibody
GPRASP2 antibody was raised using the middle region of GPRASP2 corresponding to a region with amino acids EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQATXN1 antibody
The ATXN1 antibody is a highly reactive and neutralizing polyclonal antibody that specifically targets the ATXN1 protein. This protein is involved in various cellular processes, including cell signaling and gene expression regulation. The ATXN1 antibody has been shown to be effective in blocking the activity of ATXN1, making it an ideal tool for studying its function and potential therapeutic applications. It can also be used as a diagnostic tool to detect the presence of autoantibodies against ATXN1 in human serum. The ATXN1 antibody is produced using advanced techniques and quality control measures to ensure its purity and specificity. With its high affinity and selectivity, this monoclonal antibody provides reliable results in various research settings.
E7 antibody
E7 antibody was raised in Mouse using a purified recombinant fragment of E7 expressed in E. coli as the immunogen.Cytokeratin 20 antibody
The Cytokeratin 20 antibody is a highly specific polyclonal antibody that targets the CD3 receptor. It can be used in various applications such as immunohistochemistry and flow cytometry. This antibody is reactive against alpha-fetoprotein and has been shown to have neutralizing properties. It can be used as a diagnostic reagent in the detection of certain diseases or conditions. The Cytokeratin 20 antibody is also useful in research settings for studying TGF-beta signaling, collagen synthesis, and other related processes. With its high specificity and versatility, this monoclonal antibody is a valuable tool for researchers and clinicians alike.PAGE4 antibody
PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQSAP155 antibody
The SAP155 antibody is a high-quality polyclonal antibody that is widely used in Life Sciences research. It specifically targets SAP155, a protein that plays a crucial role in various cellular processes such as splicing and gene regulation. This antibody is highly specific and has been extensively validated for its performance in immunohistochemistry, western blotting, and other applications.SSTR2 antibody
The SSTR2 antibody is a highly specialized monoclonal antibody that targets the somatostatin receptor 2 (SSTR2). This antibody has been extensively studied and characterized for its ability to specifically bind to SSTR2, making it an invaluable tool in various research applications.
c-Kit antibody
c-Kit antibody was raised in Mouse using a purified recombinant fragment of C-kit expressed in E. coli as the immunogen.KCTD16 antibody
KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLIL16 antibody
IL16 antibody was raised in Mouse using a purified recombinant fragment of human IL-16 expressed in E. coli as the immunogen.
