Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75448 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Slc25a31 antibody
Slc25a31 antibody was raised in rabbit using the middle region of Slc25a31 as the immunogen
Purity:Min. 95%PTCH2 antibody
PTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACVPurity:Min. 95%Cpne5 antibody
Cpne5 antibody was raised in rabbit using the N terminal of Cpne5 as the immunogenPurity:Min. 95%CD36 antibody
CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVPurity:Min. 95%PARVB antibody
PARVB antibody was raised using the N terminal of PARVB corresponding to a region with amino acids LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVPurity:Min. 95%ZG16 antibody
ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGPurity:Min. 95%Carbonic Anhydrase IV antibody
Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
Purity:Min. 95%PAPPA2 antibody
PAPPA2 antibody was raised using the N terminal of PAPPA2 corresponding to a region with amino acids PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLPurity:Min. 95%Transglutaminase 2 antibody
Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYPurity:Min. 95%RAB5A antibody
RAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSPurity:Min. 95%NKIRAS2 antibody
NKIRAS2 antibody was raised using the C terminal of NKIRAS2 corresponding to a region with amino acids VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDGPurity:Min. 95%ZNF154 antibody
ZNF154 antibody was raised in rabbit using the N terminal of ZNF154 as the immunogenPurity:Min. 95%GRM6 antibody
GRM6 antibody was raised in rabbit using the C terminal of GRM6 as the immunogenPurity:Min. 95%PRAC antibody
PRAC antibody was raised in rabbit using human PRAC protein as the immunogen.Purity:Min. 95%Oasl1 antibody
Oasl1 antibody was raised in rabbit using the C terminal of Oasl1 as the immunogenPurity:Min. 95%CNTF antibody
CNTF antibody was raised in rabbit using highly pure recombinant rat CNTF as the immunogen.Purity:Min. 95%GABRB1 antibody
GABRB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITPurity:Min. 95%Arf4 antibody
Arf4 antibody was raised in rabbit using the N terminal of Arf4 as the immunogenPurity:Min. 95%TMEM161A antibody
TMEM161A antibody was raised using the middle region of TMEM161A corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIRPurity:Min. 95%USP13 antibody
USP13 antibody was raised in rabbit using the N terminal of USP13 as the immunogenPurity:Min. 95%CERKL antibody
CERKL antibody was raised in rabbit using the C terminal of CERKL as the immunogenPurity:Min. 95%Alpha 1 Antichymotrypsin antibody
Alpha 1 Antichymotrypsin antibody was raised in goat using Human Alpha-1-Antichymotrypsin as the immunogen.Purity:Min. 95%TP53INP1 antibody
TP53INP1 antibody was raised in rabbit using the C terminal of TP53INP1 as the immunogenPurity:Min. 95%MMP16 antibody
MMP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYAPurity:Min. 95%CCDC117 antibody
CCDC117 antibody was raised in rabbit using the middle region of CCDC117 as the immunogenPurity:Min. 95%ACVR1C antibody
ACVR1C antibody was raised using the N terminal of ACVR1C corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVPPurity:Min. 95%RNF133 antibody
RNF133 antibody was raised using the N terminal of RNF133 corresponding to a region with amino acids VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNAPurity:Min. 95%IL17A antibody
IL17A antibody was raised in rabbit using the N terminal of IL17A as the immunogenPurity:Min. 95%RFC3 antibody
RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLPurity:Min. 95%Synaptogyrin 2 antibody
Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAPurity:Min. 95%TFR2 antibody
TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDPPurity:Min. 95%Aquaporin 10 antibody
Aquaporin 10 antibody was raised using the C terminal of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKPurity:Min. 95%KLHL4 antibody
KLHL4 antibody was raised in rabbit using the N terminal of KLHL4 as the immunogenPurity:Min. 95%TRPV4 antibody
TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRPurity:Min. 95%GALNT14 antibody
GALNT14 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYAPurity:Min. 95%B4galt5 antibody
B4galt5 antibody was raised in rabbit using the C terminal of B4galt5 as the immunogenPurity:Min. 95%IGSF11 antibody
IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL
Purity:Min. 95%CBLL1 antibody
CBLL1 antibody was raised in rabbit using the N terminal of CBLL1 as the immunogenPurity:Min. 95%ARL8A antibody
ARL8A antibody was raised using the middle region of ARL8A corresponding to a region with amino acids IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQPurity:Min. 95%MEF2A antibody
The MEF2A antibody is a monoclonal antibody that specifically targets the endogenous protein kinase MEF2A. This antibody can be used to detect and quantify the activation of MEF2A in various cell lines and tissues. It has been shown to have specific reactivity with the target molecule, making it a reliable tool for studying the function of MEF2A in cellular processes.Purity:Min. 95%SMPD2 antibody
SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVPurity:Min. 95%ZFP106 antibody
ZFP106 antibody was raised in rabbit using the N terminal of ZFP106 as the immunogenPurity:Min. 95%Bnc1 antibody
Bnc1 antibody was raised in rabbit using the C terminal of Bnc1 as the immunogen
Purity:Min. 95%TP53INP2 antibody
TP53INP2 antibody was raised in rabbit using the C terminal of TP53INP2 as the immunogenPurity:Min. 95%PQLC2 antibody
PQLC2 antibody was raised using the middle region of PQLC2 corresponding to a region with amino acids LLFLMGMACATPLLSAAGPVAAPREAFRGRALLSVESGSKPFTRQEVIGFPurity:Min. 95%Sh3glb1 antibody
Sh3glb1 antibody was raised in rabbit using the N terminal of Sh3glb1 as the immunogenPurity:Min. 95%FOLH1 antibody
FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAPurity:Min. 95%PTDSS1 antibody
PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI
Purity:Min. 95%Sarcospan antibody
Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLPurity:Min. 95%GHRHR antibody
GHRHR antibody was raised using the middle region of GHRHR corresponding to a region with amino acids PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRRPurity:Min. 95%TRPM8 antibody
TRPM8 antibody was raised using the N terminal of TRPM8 corresponding to a region with amino acids YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIPPurity:Min. 95%TRAF7 antibody
TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPRPurity:Min. 95%GTF3C5 antibody
GTF3C5 antibody was raised in rabbit using the C terminal of GTF3C5 as the immunogenPurity:Min. 95%ZNF598 antibody
ZNF598 antibody was raised in rabbit using the middle region of ZNF598 as the immunogenPurity:Min. 95%Pcyt2 antibody
Pcyt2 antibody was raised in rabbit using the N terminal of Pcyt2 as the immunogenPurity:Min. 95%NNT1 antibody
NNT1 antibody was raised in rabbit using highly pure recombinant human NNT-1/BCSF-3 as the immunogen.Purity:Min. 95%CNTNAP3 antibody
CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYAPurity:Min. 95%GSTM3 antibody
GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFPurity:Min. 95%ATP5G2 antibody
ATP5G2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAPurity:Min. 95%CCRD6 antibody
CCRD6 antibody was raised in goat using a synthetic peptide C-L10ATEDADSENSSFYYYDYLDEVAFM35L corresponding to the N-terminal extracellular domain of human D6 as the immunogen.Purity:Min. 95%SLC22A7 antibody
SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHPurity:Min. 95%IL1F5 antibody
IL1F5 antibody was raised in rabbit using the middle region of IL1F5 as the immunogenPurity:Min. 95%SLITRK6 antibody
SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL
Purity:Min. 95%B4GALNT3 antibody
B4GALNT3 antibody was raised using the N terminal of B4GALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA
Purity:Min. 95%C3orf31 antibody
C3orf31 antibody was raised in rabbit using the middle region of C3ORF31 as the immunogenPurity:Min. 95%SLC35E2 antibody
SLC35E2 antibody was raised using the middle region of SLC35E2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
Purity:Min. 95%TMEM107 antibody
TMEM107 antibody was raised in rabbit using the N terminal of TMEM107 as the immunogenPurity:Min. 95%IL10 antibody
IL10 antibody is a highly specialized monoclonal antibody that targets the protein interleukin-10 (IL-10). IL-10 is an important anti-inflammatory cytokine that plays a crucial role in regulating immune responses. This antibody specifically binds to IL-10, preventing its interaction with its receptors and inhibiting its biological activity.Purity:Min. 95%MPZL2 antibody
MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFPurity:Min. 95%ZNF780A antibody
ZNF780A antibody was raised in rabbit using the N terminal of ZNF780A as the immunogenPurity:Min. 95%ZNF785 antibody
ZNF785 antibody was raised in rabbit using the N terminal of ZNF785 as the immunogenPurity:Min. 95%SLC25A22 antibody
SLC25A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVPurity:Min. 95%Aak1 antibody
Aak1 antibody was raised in rabbit using the C terminal of Aak1 as the immunogenPurity:Min. 95%2610034B18Rik antibody
2610034B18Rik antibody was raised in rabbit using the N terminal of 2610034B18Rik as the immunogenPurity:Min. 95%OAT antibody
OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVPurity:Min. 95%SIGLEC6 antibody
SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLPurity:Min. 95%Angiopoietin 2 antibody
Angiopoietin 2 antibody was raised in rabbit using 20-aa peptide from mouse Ang-2 as the immunogen.Purity:Min. 95%Metaxin 1 antibody
Metaxin 1 antibody was raised using the C terminal of MTX1 corresponding to a region with amino acids CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRGPurity:Min. 95%UGT1A9 antibody
UGT1A9 antibody was raised using the N terminal of UGT1A9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVPurity:Min. 95%Scg3 antibody
Scg3 antibody was raised in rabbit using the C terminal of Scg3 as the immunogenPurity:Min. 95%GHRHR antibody
GHRHR antibody was raised using the N terminal of GHRHR corresponding to a region with amino acids VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE
Purity:Min. 95%ZNF548 antibody
ZNF548 antibody was raised in rabbit using the C terminal of ZNF548 as the immunogen
Purity:Min. 95%Ubxn2a antibody
Ubxn2a antibody was raised in rabbit using the middle region of Ubxn2a as the immunogenPurity:Min. 95%ZNF138 antibody
ZNF138 antibody was raised in rabbit using the C terminal of ZNF138 as the immunogenPurity:Min. 95%ADAM12 antibody
ADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEPurity:Min. 95%ZBTB32 antibody
ZBTB32 antibody was raised in rabbit using the N terminal of ZBTB32 as the immunogenPurity:Min. 95%ZNF474 antibody
ZNF474 antibody was raised in rabbit using the middle region of ZNF474 as the immunogenPurity:Min. 95%APLNR antibody
APLNR antibody was raised in rabbit using the N terminal of APLNR as the immunogenPurity:Min. 95%GEM antibody
GEM antibody was raised using the N terminal of GEM corresponding to a region with amino acids KEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQPurity:Min. 95%PCSK6 antibody
PCSK6 antibody was raised in rabbit using the N terminal of PCSK6 as the immunogenPurity:Min. 95%TMEM79 antibody
TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWGPurity:Min. 95%EVI2A antibody
EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogenPurity:Min. 95%SLC6A14 antibody
SLC6A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFWPurity:Min. 95%Eotaxin 2 antibody
Eotaxin 2 antibody was raised in goat using highly pure recombinant human eotaxin-2 as the immunogen.Purity:Min. 95%CCDC110 antibody
CCDC110 antibody was raised in rabbit using the middle region of CCDC110 as the immunogenPurity:Min. 95%GALNT6 antibody
GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRNPurity:Min. 95%
