Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Thrombopoietin antibody
Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPurity:Min. 95%RFXB antibody
RFXB antibody was raised in rabbit using residues 18-31 [ASELGDPEDPGEEAC] of the RFX-B protein as the immunogen.Purity:Min. 95%Factor X antibody
Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQPurity:Min. 95%ZNF566 antibody
ZNF566 antibody was raised in rabbit using the middle region of ZNF566 as the immunogenPurity:Min. 95%P4HB antibody
P4HB antibody was raised using the N terminal of P4HB corresponding to a region with amino acids TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVPurity:Min. 95%Abcc2 antibody
Abcc2 antibody was raised in rabbit using the middle region of Abcc2 as the immunogenPurity:Min. 95%PA2G4 antibody
PA2G4 antibody was raised in rabbit using the C terminal of PA2G4 as the immunogenPurity:Min. 95%Angel1 antibody
Angel1 antibody was raised in rabbit using the C terminal of Angel1 as the immunogen
Purity:Min. 95%Vps45 antibody
Vps45 antibody was raised in rabbit using the C terminal of Vps45 as the immunogenPurity:Min. 95%Collagen Type VI Alpha 1 antibody
Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
Purity:Min. 95%RGS3 antibody
RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPLPurity:Min. 95%UCHL1 antibody
UCHL1 antibody was raised in rabbit using the C terminal of UCHL1 as the immunogenPurity:Min. 95%CLN8 antibody
CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAVPurity:Min. 95%NKIRAS2 antibody
NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPurity:Min. 95%SCN3B antibody
SCN3B antibody was raised using the N terminal of SCN3B corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDPurity:Min. 95%FGG antibody
FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQPurity:Min. 95%LEC antibody
LEC antibody was raised in goat using highly pure recombinant human LEC as the immunogen.Purity:Min. 95%MDM2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.Purity:Min. 95%WNT5B antibody
WNT5B antibody was raised using the middle region of WNT5B corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCPurity:Min. 95%STK38 antibody
STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDPurity:Min. 95%HEPACAM antibody
HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTPurity:Min. 95%TBK1 antibody
TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM
Purity:Min. 95%LONRF2 antibody
LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHRPurity:Min. 95%Gal3st4 antibody
Gal3st4 antibody was raised in rabbit using the C terminal of Gal3st4 as the immunogenPurity:Min. 95%IFN Alpha 7 antibody
IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
Purity:Min. 95%Gm527 antibody
Gm527 antibody was raised in rabbit using the C terminal of Gm527 as the immunogenPurity:Min. 95%PLUNC antibody
PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLPurity:Min. 95%Septin 11 antibody
Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETPurity:Min. 95%CRMP1 antibody
CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS
Purity:Min. 95%Cytokeratin AE1 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin AE1 antibody (Prediluted for IHC)Purity:Min. 95%ABCG5 antibody
ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
Purity:Min. 95%SLC14A1 antibody
SLC14A1 antibody was raised using the C terminal of SLC14A1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGMPurity:Min. 95%Smarcd3 antibody
Smarcd3 antibody was raised in rabbit using the C terminal of Smarcd3 as the immunogenPurity:Min. 95%GNAS antibody
GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDPurity:Min. 95%IL28R alpha antibody
IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFPurity:Min. 95%HMGB4 antibody
HMGB4 antibody was raised in rabbit using the C terminal of HMGB4 as the immunogenPurity:Min. 95%ZNF641 antibody
ZNF641 antibody was raised in rabbit using the middle region of ZNF641 as the immunogenPurity:Min. 95%ING4 antibody
ING4 antibody was raised in rabbit using the middle region of ING4 as the immunogenPurity:Min. 95%ANGPT4 antibody
ANGPT4 antibody was raised using the N terminal of ANGPT4 corresponding to a region with amino acids TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT
Purity:Min. 95%IL4 antibody
IL4 antibody was raised in rabbit using highly pure recombinant rat IL-4 as the immunogen.Purity:Min. 95%APOL5 antibody
APOL5 antibody was raised in rabbit using the C terminal of APOL5 as the immunogenPurity:Min. 95%EHD1 antibody
EHD1 antibody was raised in rabbit using the middle region of EHD1 as the immunogenPurity:Min. 95%XK antibody
XK antibody was raised using a synthetic peptide corresponding to a region with amino acids LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEPurity:Min. 95%EXOC4 antibody
EXOC4 antibody was raised in rabbit using the N terminal of EXOC4 as the immunogenPurity:Min. 95%CYP1A1 antibody
CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
Purity:Min. 95%Park2 antibody
Park2 antibody was raised in rabbit using the C terminal of Park2 as the immunogenPurity:Min. 95%mGluR2/3 antibody
mGluR2/3 antibody was raised in rabbit using residues 860-872 [NGREVVDSTTSSL] of the rat mGlurR2/3 protein as the immunogen.Purity:Min. 95%NPY1R antibody
NPY1R antibody was raised in rabbit using a 15 amino acid peptide from mouse NPY1R as the immunogen.Purity:Min. 95%ECT2 antibody
ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLPurity:Min. 95%LRRC25 antibody
LRRC25 antibody was raised using the N terminal of LRRC25 corresponding to a region with amino acids AEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQPurity:Min. 95%NPM2 antibody
NPM2 antibody was raised using the N terminal of NPM2 corresponding to a region with amino acids LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQAPurity:Min. 95%NOV antibody
NOV antibody was raised in rabbit using highly pure recombinant human NOV as the immunogen.Purity:Min. 95%SLC25A11 antibody
SLC25A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMPurity:Min. 95%VTN antibody
VTN antibody was raised in rabbit using the N terminal of VTN as the immunogenPurity:Min. 95%LIGHT antibody
LIGHT antibody was raised in rabbit using highly pure recombinant human LIGHT as the immunogen.
Purity:Min. 95%Ap3b1 antibody
Ap3b1 antibody was raised in rabbit using the N terminal of Ap3b1 as the immunogenPurity:Min. 95%AURKA antibody
AURKA antibody was raised in rabbit using the C terminal of AURKA as the immunogenPurity:Min. 95%HS2ST1 antibody
HS2ST1 antibody was raised using the middle region of HS2ST1 corresponding to a region with amino acids GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTIPurity:Min. 95%RDH16 antibody
RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDAPurity:Min. 95%IGSF9 antibody
IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA
Purity:Min. 95%FCN1 antibody
FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAPurity:Min. 95%NFATc2 antibody
NFATc2 antibody was raised in rabbit using residues 269-281 [ASPQRSRSPSPQP] of the human NFATc2 protein as the immunogen.Purity:Min. 95%IRF4 antibody
The IRF4 antibody is a polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to the Interferon Regulatory Factor 4 (IRF4), a protein involved in various cellular processes. This antibody is commonly used in research to study the role of IRF4 in different biological systems.Purity:Min. 95%OAS2 antibody
OAS2 antibody was raised using the N terminal of OAS2 corresponding to a region with amino acids DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLPurity:Min. 95%LOC731673 antibody
LOC731673 antibody was raised in rabbit using the C terminal of LOC731673 as the immunogen
Purity:Min. 95%RRAD antibody
RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG
Purity:Min. 95%SIDT2 antibody
SIDT2 antibody was raised using the N terminal of SIDT2 corresponding to a region with amino acids LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPTPurity:Min. 95%ST3GAL4 antibody
ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVPurity:Min. 95%SLC43A2 antibody
SLC43A2 antibody was raised using the N terminal of SLC43A2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLSPurity:Min. 95%MOSPD2 antibody
MOSPD2 antibody was raised using the middle region of MOSPD2 corresponding to a region with amino acids TPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTESTPurity:Min. 95%NOMO1 antibody
NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASDPurity:Min. 95%ZNF791 antibody
ZNF791 antibody was raised in rabbit using the middle region of ZNF791 as the immunogenPurity:Min. 95%CADM3 antibody
CADM3 antibody was raised in rabbit using the middle region of CADM3 as the immunogenPurity:Min. 95%HSZFP36 antibody
HSZFP36 antibody was raised in rabbit using the middle region of HSZFP36 as the immunogenPurity:Min. 95%RBM5 antibody
RBM5 antibody was raised in rabbit using the N terminal of RBM5 as the immunogenPurity:Min. 95%SLC20A2 antibody
SLC20A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFPurity:Min. 95%Upp2 antibody
Upp2 antibody was raised in rabbit using the C terminal of Upp2 as the immunogenPurity:Min. 95%TANK antibody
TANK antibody was raised in rabbit using the C terminal of TANK as the immunogenPurity:Min. 95%SLC25A16 antibody
SLC25A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRPurity:Min. 95%CCL16 antibody
CCL16 antibody was raised in rabbit using the N terminal of CCL16 as the immunogenPurity:Min. 95%NFKBIE antibody
NFKBIE antibody was raised in rabbit using the middle region of NFKBIE as the immunogenPurity:Min. 95%ACVR2B antibody
ACVR2B antibody was raised using the middle region of ACVR2B corresponding to a region with amino acids LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVPurity:Min. 95%ALOX15B antibody
ALOX15B antibody was raised in rabbit using the middle region of ALOX15B as the immunogenPurity:Min. 95%MEIS3 antibody
MEIS3 antibody was raised in rabbit using the middle region of MEIS3 as the immunogenPurity:Min. 95%HADH antibody
HADH antibody was raised in rabbit using the middle region of HADH as the immunogenPurity:Min. 95%LRRC8B antibody
LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS
Purity:Min. 95%MCP3 antibody
MCP3 antibody was raised in goat using highly pure recombinant murine MCP-3 as the immunogen.Purity:Min. 95%Slc22a3 antibody
Slc22a3 antibody was raised in rabbit using the middle region of Slc22a3 as the immunogenPurity:Min. 95%ApoA-IV antibody
ApoA-IV antibody was raised using the C terminal of APOA4 corresponding to a region with amino acids RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQPurity:Min. 95%ERK1 antibody
The ERK1 antibody is a highly specialized antibody that is used for the detection and analysis of activated ERK1 protein. This antibody has been extensively tested and validated for its specificity and sensitivity in various research applications. It is commonly used in studies involving ginseng, botulinum, histidine protein, and other related fields.
Purity:Min. 95%USP9Y antibody
USP9Y antibody was raised in rabbit using the C terminal of USP9Y as the immunogenPurity:Min. 95%RASL12 antibody
RASL12 antibody was raised using the N terminal of RASL12 corresponding to a region with amino acids MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYDPurity:Min. 95%Claudin 7 antibody
Claudin 7 antibody was raised using the C terminal of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYVPurity:Min. 95%TBL1Y antibody
TBL1Y antibody was raised in rabbit using the middle region of TBL1Y as the immunogen
Purity:Min. 95%RAD1 antibody
RAD1 antibody was raised in rabbit using the middle region of RAD1 as the immunogenPurity:Min. 95%Thymopoietin antibody
Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPurity:Min. 95%PTCH1 antibody
PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAMPurity:Min. 95%PTDSR antibody
PTDSR antibody was raised in rabbit using the middle region of PTDSR as the immunogenPurity:Min. 95%
