Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CD9 antibody
The CD9 antibody is a monoclonal antibody that belongs to the class of antibodies known as polyclonal antibodies. It specifically targets CD9, a protein that is involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of fibroin and natriuretic factors. Additionally, it has been found to have anti-VEGF activity, which makes it a potential candidate for anti-angiogenic therapy. The CD9 antibody also plays a role in hormone regulation and has been shown to modulate endothelial growth. In liver microsomes, this antibody acts as an inhibitor of caspase-9, thus preventing apoptosis. Furthermore, it has been found to interact with fatty acids and β-catenin, suggesting its involvement in lipid metabolism and cell signaling pathways. Overall, the CD9 antibody is a versatile tool with diverse applications in research and pharmaceutical development.
ApoBEC3F antibody
ApoBEC3F antibody was raised using the N terminal of APOBEC3F corresponding to a region with amino acids MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDNorovirus antibody
Norovirus antibody was raised in mouse using purified native norwalk virus, strain 8Flla as the immunogen.IL19 antibody
IL19 antibody is a monoclonal antibody that targets interleukin-19 (IL-19), a protein involved in various inflammatory processes. IL-19 is known to play a role in the development of amyloid plaques, which are associated with Alzheimer's disease. This antibody specifically binds to IL-19 and inhibits its activity, potentially reducing inflammation and the formation of amyloid plaques. Additionally, IL19 antibody has been shown to inhibit the growth of cancer cells by targeting proteins such as mesothelin and E-cadherin. It may also have potential therapeutic applications in other diseases characterized by abnormal immune responses or inflammation. With its high specificity and efficacy, IL19 antibody is a valuable tool for researchers in the field of Life Sciences studying cytokine biology and developing novel therapies.PKC epsilon antibody
PKC epsilon antibody is a polyclonal antibody that specifically targets the MERTK protein. This antibody is commonly used in life sciences research to study the role of MERTK in various cellular processes. MERTK is a receptor tyrosine kinase involved in the regulation of cell growth, survival, and differentiation. It plays a crucial role in the immune response, particularly in the clearance of apoptotic cells and antiviral defense mechanisms mediated by interferon signaling. The PKC epsilon antibody has been shown to be highly reactive and exhibits strong binding affinity towards MERTK. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry analysis. Researchers can rely on this high-quality antibody to accurately detect and quantify MERTK expression levels in different tissues or cell types. Its specificity and reliability make it an invaluable tool for studying the function and regulation of MERTK in various biological processes.
SUCNR1 antibody
The SUCNR1 antibody is a highly specialized antibody that is used in the field of Life Sciences. It has been extensively tested and proven to be effective in various applications. This monoclonal antibody specifically targets SUCNR1, a receptor that plays a crucial role in various biological processes.CLEC14A antibody
The CLEC14A antibody is a monoclonal antibody that acts as an inhibitor of the glycoprotein CLEC14A. This antibody specifically targets CLEC14A and can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting. It is commonly used in life sciences research to study the role of CLEC14A in different cellular processes.IGF1R antibody
The IGF1R antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the insulin-like growth factor 1 receptor (IGF1R), which plays a crucial role in cell growth, differentiation, and survival. By binding to IGF1R, this antibody effectively blocks the activation of downstream signaling pathways involved in these processes.
NEK4 antibody
NEK4 antibody was raised in mouse using recombinant Human Nima (Never In Mitosis Gene A)-Related Kinase 4Estrogen Receptor antibody
Estrogen Receptor antibody was raised in Mouse using a purified recombinant fragment of ER expressed in E. coli as the immunogen.
DHX34 antibody
DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGDFlt1 antibody
Flt1 antibody was raised in Mouse using purified recombinant extracellular fragment of human Flt1 fused with hIgGFc tag expressed in HEK293 cells as the immunogen.PRDX1 antibody
The PRDX1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets and binds to Peroxiredoxin-1 (PRDX1), a protein involved in various cellular processes such as antioxidant defense and cell signaling. This monoclonal antibody has been extensively studied for its therapeutic potential in diseases like cancer, diabetes, and cardiovascular disorders.TAU antibody
The TAU antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to TAU protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody can be used for various applications, including research studies, diagnostic purposes, and therapeutic interventions.ApoA-I antibody
ApoA-I antibody was raised in Mouse using a purified recombinant fragment of human APOA1 expressed in E. coli as the immunogen.CD54 antibody
The CD54 antibody is a highly specific antigen-binding protein that belongs to the group of polyclonal and monoclonal antibodies. It is widely used in life sciences research for its ability to target and bind to CD54, also known as intercellular adhesion molecule-1 (ICAM-1). This glycoprotein plays a crucial role in cell-to-cell interactions and immune response modulation.TGF beta 1 antibody
The TGF beta 1 antibody is a monoclonal antibody that specifically targets the growth factor TGF-beta 1. This antibody is reactive and can be used in various applications within the Life Sciences field. It has been shown to be effective in neutralizing the activity of TGF-beta 1, which plays a crucial role in cell proliferation, differentiation, and immune response regulation. The TGF beta 1 antibody is polymorphic, meaning it can recognize different forms of the target protein due to its specificity for specific epitopes. It has been successfully used in experiments involving imatinib-treated human serum samples, where it demonstrated its ability to detect activated TGF-beta 1. This antibody can be utilized in techniques such as immunoblotting and electrophoresis to study the expression and function of TGF-beta 1 in various biological systems.cMyc antibody
The cMyc antibody is a highly specialized molecule drug used in Life Sciences research. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and apoptosis. This antibody specifically targets the cMyc protein, which is involved in regulating gene expression.MTHFD1 antibody
MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGHPRT antibody
HPRT antibody was raised in Mouse using a purified recombinant fragment of HPRT expressed in E. coli as the immunogen.GPR101 antibody
The GPR101 antibody is a highly versatile and potent monoclonal antibody that has a wide range of applications in the field of Life Sciences. This antibody acts as an anticoagulant by inhibiting the activation of fibrinogen, a key player in the blood clotting process. Additionally, it functions as a growth factor, promoting the development and maintenance of microvessel density.PPIE antibody
PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGBRCC36 antibody
BRCC36 antibody was raised in mouse using recombinant BRCC36 (1-316aa) purified from E. coli as the immunogen.Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a monoclonal antibody that specifically targets the estrogen receptor alpha protein. This antibody has been extensively studied and shown to have neutralizing properties against the estrogen receptor alpha, which plays a crucial role in various physiological processes such as adipose tissue development and regulation.
ACRBP antibody
The ACRBP antibody is a highly specialized phosphatase that plays a crucial role in various biological processes. This polyclonal antibody is widely used in life sciences research to study hepatic lipase and its impact on lipid metabolism. It has been shown to have a significant effect on the viscosity of lipoprotein lipase, making it an essential tool for understanding the mechanisms underlying lipid metabolism disorders.LOC650515 antibody
LOC650515 antibody was raised using the C terminal of LOC650515 corresponding to a region with amino acids VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLISMO antibody
The SMO antibody is a highly versatile protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications.E2F1 antibody
The E2F1 antibody is a highly effective research tool used in the field of Life Sciences. It is a polyclonal antibody that has been specifically designed to target and detect E2F1, a transcription factor involved in cell cycle regulation and tumor development. This antibody has been extensively tested and validated for its specificity and sensitivity.STAT6 antibody
The STAT6 antibody is a highly specialized protein used in the field of Life Sciences. It is an essential tool for researchers studying various aspects of cellular function and signaling pathways. This antibody specifically targets the STAT6 protein, which plays a crucial role in mediating cellular responses to growth factors and cytokines.KLC3 antibody
KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids LLCQNQGKFEDVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKMAOA antibody
MAOA antibody was raised using the N terminal of MAOA corresponding to a region with amino acids GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAACTR2 antibody
ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEPTPN2 antibody
The PTPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both a monoclonal and polyclonal antibody. This antibody specifically targets and binds to the PTPN2 protein, which plays a crucial role in various biological processes.
STK32A antibody
STK32A antibody was raised using the N terminal of STK32A corresponding to a region with amino acids GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMAPLP2 antibody
The APLP2 antibody is a highly targeted molecule used in Life Sciences. It is a polyclonal antibody that specifically binds to the APLP2 protein, which is a basic protein involved in various cellular processes. This antibody can be used in research and diagnostic applications to detect and quantify APLP2 levels in samples.CNOT6 antibody
CNOT6 antibody was raised in mouse using recombinant Human Ccr4-Not Transcription Complex, Subunit 6KCNMB4 antibody
KCNMB4 antibody was raised using the middle region of KCNMB4 corresponding to a region with amino acids TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCKCD29 antibody
The CD29 antibody is a specific antibody used for ultrasensitive detection in human serum. It is commonly used in Life Sciences research and pharmaceutical preparations. This monoclonal antibody specifically targets the CD29 protein, which plays a crucial role in cell adhesion and migration. The CD29 antibody can be used to detect autoantibodies or protein carbonyls in various biological samples. It has been shown to have high sensitivity and specificity, making it an ideal tool for research and diagnostic purposes. The CD29 antibody can be easily conjugated to different labels or immobilized on surfaces such as aluminum hydroxide or electrodes for use in techniques like electrochemical impedance spectroscopy. With its versatility and reliability, the CD29 antibody is an essential tool for scientists and researchers working in various fields of study.WEE1 antibody
The WEE1 antibody is a reactive monoclonal antibody that specifically binds to erythropoietin (EPO) and its receptor. It has been shown to inhibit the activation of the EPO receptor, preventing downstream signaling events. This antibody can be used in various applications, including immunoassays and immunohistochemistry, to detect and quantify EPO levels in human serum or tissue samples. The WEE1 antibody can also be immobilized on a colloidal electrode for use in biosensors or other diagnostic devices. Its high affinity and specificity make it a valuable tool for researchers in the field of life sciences studying EPO and its associated binding proteins.ERK1/2 antibody
The ERK1/2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the activated forms of protein kinase ERK1 and ERK2. This antibody plays a crucial role in studying various cellular processes, including angiogenesis, cell growth, and differentiation.VE Cadherin antibody
The VE Cadherin antibody is a monoclonal antibody that specifically targets the endothelial cadherin, a cell adhesion molecule involved in cell-cell interactions. This antibody can be used for various applications in life sciences research, including immunohistochemistry, western blotting, and flow cytometry.GLP1 antibody
The GLP1 antibody is a low-molecular-weight chemokine that belongs to the class of monoclonal antibodies. It is specifically designed to target and neutralize the growth factor known as epidermal growth factor (EGF). This antibody has been shown to have antiangiogenic properties, meaning it can inhibit the formation of new blood vessels that are necessary for tumor growth. Additionally, the GLP1 antibody can induce apoptosis, or programmed cell death, in cancer cells by activating caspase-9. This monoclonal antibody has been extensively studied in the field of life sciences and has shown promising results as a potential therapeutic agent for various types of cancers.
Cofilin antibody
Cofilin antibody is a monoclonal antibody that specifically targets cofilin, a protein involved in actin dynamics and cell motility. This antibody has been shown to have low density on the cell surface, making it an ideal candidate for immunofluorescence and flow cytometry experiments. Cofilin antibody can be used in various research applications, including the study of antibodies, autoantibodies, interferons, growth factors, and antiphospholipid antibodies. Additionally, this antibody has been used in combination with trastuzumab, an anti-HER2 antibody, to enhance its therapeutic effects. With its high specificity and affinity for cofilin, this monoclonal antibody is a valuable tool for researchers studying cellular processes such as caffeine signaling, β-catenin regulation, epidermal growth factor signaling, and amino group modifications.
