Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GALNTL4 antibody
GALNTL4 antibody was raised using the middle region of GALNTL4 corresponding to a region with amino acids IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVPurity:Min. 95%TECK antibody
TECK antibody was raised in rabbit using highly pure recombinant human TECK as the immunogen.Purity:Min. 95%CMA1 antibody
CMA1 antibody was raised in rabbit using the C terminal of CMA1 as the immunogenPurity:Min. 95%Goat anti Rabbit IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%C14ORF172 antibody
C14ORF172 antibody was raised using the N terminal Of C14Orf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIHAL antibody
HAL antibody was raised using the C terminal of HAL corresponding to a region with amino acids EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKTOR1B antibody
TOR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDAVPR1B antibody
The AVPR1B antibody is a highly effective monoclonal antibody that targets the AVPR1B receptor. This receptor plays a crucial role in various biological processes, including the regulation of stress response and social behavior. By specifically binding to the AVPR1B receptor, this antibody inhibits its activity and modulates the downstream signaling pathways.ATF4 antibody
The ATF4 antibody is a highly specific polyclonal antibody that is used in various life science applications. It specifically targets the activating transcription factor 4 (ATF4), which plays a crucial role in cellular processes such as growth, differentiation, and stress response.
PDCD2 antibody
The PDCD2 antibody is a highly specialized monoclonal antibody that targets a specific molecule in human hepatocytes. It is designed to recognize and bind to the carboxyl terminal of the target molecule, allowing for precise detection and analysis. This antibody is derived from a hybridoma cell line, resulting in a chimeric protein that combines the specificity of human antibodies with the stability of bovine γ-globulin. The PDCD2 antibody has been extensively tested in various Life Sciences applications, including hybridization studies and immunohistochemistry. Its unique properties make it an invaluable tool for researchers studying natriuretic factors, chemokines, and other important signaling molecules. Trust the PDCD2 antibody to provide accurate and reliable results in your experiments.KCNA10 antibody
KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFWPEG10 antibody
The PEG10 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor GM-CSF (colony-stimulating factor). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications. It has been found to inhibit the activity of phosphatase, which plays a crucial role in cell growth and differentiation. Additionally, the PEG10 antibody has been shown to have an impact on adipocyte function, making it a promising candidate for research in obesity and metabolic disorders. With its high specificity and affinity for its target, this antibody is a valuable tool for scientists working in various areas of biomedical research.MGC51025 antibody
MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKHPLAT antibody
The PLAT antibody is a monoclonal antibody that specifically targets fibrinogen. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody has shown excellent binding affinity and specificity for fibrinogen, making it an ideal tool for various experimental techniques.Vitronectin antibody
Vitronectin antibody was raised in sheep using human Vitronectin purified from plasma as the immunogen.Keratin 15 antibody
The Keratin 15 antibody is a glycopeptide that targets the human serum androgen. It is an essential tool for researchers in the field of Life Sciences, as it plays a crucial role in various cellular processes. This antibody specifically recognizes Keratin 15, which is a protein involved in the maintenance and integrity of epithelial tissues.NFIL3 antibody
The NFIL3 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to the NFIL3 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in experiments involving acetylation, methyl transferase activity, and the activation of antinociceptive pathways.NQO1 antibody
The NQO1 antibody is a highly specialized monoclonal antibody that has been developed for immunoassays. It is designed to specifically target and neutralize the NQO1 protein, which plays a crucial role in cellular processes such as collagen synthesis, growth factor signaling, and tyrosine kinase receptor activation. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting NQO1 in various biological samples.Podoplanin antibody
The Podoplanin antibody is a mouse monoclonal antibody that specifically targets the antigen binding domain of Podoplanin. This antibody is designed to recognize and bind to Podoplanin, a human protein that serves as a potential biomarker in various biological processes. The antibody has been extensively tested and validated for its specificity and sensitivity in detecting Podoplanin in different samples.
LIMK1 antibody
The LIMK1 antibody is a highly specialized phosphatase that plays a crucial role in various cellular processes. It binds to specific proteins and regulates their activity, making it an essential component for normal cell function. This antibody has been found to have antiangiogenic properties, meaning it inhibits the formation of new blood vessels. Additionally, it interacts with natriuretic peptides, which are hormones involved in regulating blood pressure and fluid balance. The LIMK1 antibody is commonly used in Life Sciences research to study the effects of growth factors such as epidermal growth factor and endothelial growth factor. Its unique binding properties make it a valuable tool for understanding complex signaling pathways and molecular interactions within cells.SARS M antibody
SARS M antibody was raised in Mouse using a purified recombinant fragment of SARS-m protein expressed in E. coli as the immunogen.DRB1 antibody
DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDMMP19 antibody
MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWROSR1 antibody
The OSR1 antibody is a powerful tool in the field of life sciences. It is an interferon and glucagon-neutralizing antibody that has been extensively used in various research studies. This polyclonal antibody specifically targets OSR1 (oxidative stress-responsive 1) protein, which plays a crucial role in cellular processes related to growth, development, and homeostasis.FGFR4 antibody
FGFR4 antibody was raised in Mouse using a purified recombinant fragment of FGFR4 expressed in E. coli as the immunogen.Calmodulin antibody
The Calmodulin antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets calmodulin, a protein that plays a crucial role in various cellular processes such as growth factor signaling, regulation of enzymes like pancreatic elastase, and calcium-dependent processes in human hepatocytes. This antibody has been extensively used in research to study the function and localization of calmodulin in different cell types and tissues.IKBKB antibody
IKBKB antibody was raised in Mouse using a purified recombinant fragment of IKBKB expressed in E. coli as the immunogen.PRSS3 antibody
PRSS3 antibody was raised using the N terminal of PRSS3 corresponding to a region with amino acids VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHHNRPF antibody
HNRPF antibody was raised using the C terminal of HNRPF corresponding to a region with amino acids LNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSEpoR antibody
The EpoR antibody is a life sciences product that specifically targets the erythropoietin receptor (EpoR). It is a polyclonal antibody that can be used in various applications, including research and diagnostics. The EpoR antibody binds to the EpoR protein, which is a nuclear receptor involved in erythropoiesis. By targeting this receptor, the antibody can modulate the signaling pathway and affect important biological processes such as red blood cell production.HBP1 antibody
The HBP1 antibody is a polyclonal antibody that targets hepatocyte growth factor. It is used in research and diagnostic applications to detect and quantify the expression levels of HBP1. This antibody specifically binds to HBP1 and can be used for various immunoassays, including Western blotting, immunohistochemistry, and ELISA. The HBP1 antibody has been shown to have high specificity and sensitivity in detecting HBP1 in various samples. It is a valuable tool for studying the role of HBP1 in different biological processes, such as cell growth, differentiation, and development. The HBP1 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. With its reliable performance and versatility, the HBP1 antibody is an essential tool for scientists working in the field of cellular biology and molecular medicine.FABP4 antibody
FABP4 antibody was raised in Mouse using a purified recombinant fragment of FABP4(aa61-121) expressed in E. coli as the immunogen.
Macrophage Scavenger Receptor antibody
Macrophage scavenger receptor antibody was raised in rat using Raw 264 cell line as the immunogen.IFN γ antibody (biotin)
IFN gamma antibody (biotin) was raised in mouse using human IFN-gamma as the immunogen.ATIC antibody
ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTProtein S antibody (HRP)
Protein S antibody (HRP) was raised in goat using human Protein S purified from plasma as the immunogen.RHOB antibody
RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYDonkey anti Mouse IgG (H + L) (rhodamine)
Donkey anti-mouse IgG (H + L) (rhodamine) was raised in donkey using murine IgG (H&L) as the immunogen.NET1 antibody
NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRKCNN1 antibody
KCNN1 antibody was raised using the C terminal of KCNN1 corresponding to a region with amino acids KIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD
hnRNPF antibody
The hnRNPF antibody is a polyclonal antibody that is used in various diagnostic applications. It is highly reactive and can be used to detect the presence of hnRNPF, a serine protease, in biological samples. This antibody has neutralizing properties and can be used to inhibit the activity of hnRNPF in experimental settings. It is commonly used as a diagnostic reagent in research laboratories and clinical settings.cSRC antibody
The cSRC antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. This antibody specifically targets the activated form of the cSRC protein, which plays a crucial role in cell signaling and regulation.
ARHGAP15 antibody
ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQMLKL antibody
The MLKL antibody is a highly specialized product in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody has been extensively studied for its neuroprotective properties and has shown promising results in various research studies.
PPIH antibody
PPIH antibody was raised using a synthetic peptide corresponding to a region with amino acids VVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDG
