Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RSK1 antibody
The RSK1 antibody is a highly specialized antibody that targets the lipoprotein lipase, an enzyme involved in triglyceride metabolism. This polyclonal antibody is designed to specifically bind to the lipoprotein lipase and inhibit its activity. It can be used in various research applications in the field of life sciences, including studies on lipid metabolism, adipose tissue biology, and growth factor signaling pathways.IGF1R antibody
The IGF1R antibody is a growth factor that belongs to the class of antibodies. It is commonly used in Life Sciences and interferon research. This antibody has been shown to have neutralizing properties and can target molecules involved in various biological processes. It is particularly effective against multidrug-resistant viruses and can inhibit the activity of chemokines. The IGF1R antibody is produced using both polyclonal and monoclonal techniques, ensuring high specificity and potency. Its unique structure allows it to bind to specific target molecules, blocking their function and preventing further cellular activity. With its extensive o-glycosylation and acid residue composition, this antibody offers exceptional stability and durability. Researchers rely on the IGF1R antibody for accurate and reliable results in their experiments, making it an essential tool in the field of Life Sciences.RGS20 antibody
RGS20 antibody was raised using the middle region of RGS20 corresponding to a region with amino acids NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSC14ORF140 antibody
C14ORF140 antibody was raised using the N terminal Of C14Orf140 corresponding to a region with amino acids QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLKFCHO1 antibody
FCHO1 antibody was raised using the middle region of FCHO1 corresponding to a region with amino acids SPENVEDSGLDSPSHAAPGPSPDSWVPRPGTPQSPPSCRAPPPEARGIRACSRP1 antibody
The CSRP1 antibody is a monoclonal antibody that specifically targets the CSRP1 protein. This protein is involved in various cellular processes, including cell growth and differentiation. The CSRP1 antibody can be used in research settings to study the function and regulation of CSRP1 in different cell types.
C1ORF96 antibody
C1ORF96 antibody was raised using the N terminal Of C1Orf96 corresponding to a region with amino acids LGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPP
CTNNB1 antibody
CTNNB1 antibody was raised in Mouse using a purified recombinant fragment of human CTNNB1 expressed in E. coli as the immunogen.GART antibody
GART antibody was raised using the middle region of GART corresponding to a region with amino acids VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIVFANCL antibody
FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIYp11 antibody
p11 antibody was raised in Mouse using a purified recombinant fragment of human p11 expressed in E. coli as the immunogen.Adenovirus antibody (biotin)
Adenovirus antibody (biotin) was raised in goat using hexon from ADV, type 2 as the immunogen.TRPM8 antibody
The TRPM8 antibody is a highly specialized polyclonal antibody that targets the TRPM8 protein. This protein is an important component of the dopamine signaling pathway and plays a crucial role in various physiological processes. The TRPM8 antibody is specifically designed to recognize and bind to the TRPM8 protein, allowing for its detection and quantification in biological samples.14-3-3 gamma antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It stands out as the most effective rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its high activity in humans has been demonstrated through patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, thus inhibiting cell growth in culture.
CALR antibody
The CALR antibody is a highly specialized product used in the field of life sciences. It is an adipose-specific monoclonal antibody that targets the calreticulin (CALR) protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to have cytotoxic effects on adipocytes, making it an important tool for research related to obesity and metabolic disorders.PDIA6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. Extensive studies have shown its high efficacy through various techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes several metabolic transformations, making it highly versatile in combating mycobacterium infections. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains, this drug effectively inhibits cell growth in culture.CD3e antibody (Azide Free)
CD3e antibody (Azide free) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.
NF kappaB p65 antibody
The NF kappaB p65 antibody is a polyclonal antibody that specifically targets the NF kappaB p65 protein. This protein plays a crucial role in regulating the immune response and inflammatory processes in the body. By binding to the NF kappaB p65 protein, this antibody can inhibit its activity and prevent the activation of genes involved in inflammation.Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a highly specialized antibody used in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets the estrogen receptor alpha, which plays a crucial role in various physiological processes. This antibody can be used for research purposes to study the function and regulation of the estrogen receptor alpha.KIAA0776 antibody
KIAA0776 antibody was raised using the middle region of KIAA0776 corresponding to a region with amino acids EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIRMASP2 antibody
The MASP2 antibody is a highly specialized monoclonal antibody used in immunoassays and research within the Life Sciences field. It is designed to specifically target and bind to the MASP2 protein, which plays a crucial role in the activation of the complement system.FITC antibody
The FITC antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that is designed to neutralize specific targets. The FITC antibody has been extensively studied and optimized for use in various applications, including immunoassays, flow cytometry, and immunohistochemistry.Myc antibody
The Myc antibody is a highly specialized antibody that targets and binds to the c-Myc protein. This protein plays a crucial role in various cellular processes, including cell growth, proliferation, and differentiation. The Myc antibody is widely used in life sciences research to study the function and regulation of c-Myc.ZRSR2 antibody
ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHMetadherin antibody
Metadherin antibody was raised in Mouse using a purified recombinant fragment of human MTDH expressed in E. coli as the immunogen.ARG2 antibody
The ARG2 antibody is a highly specialized antibody that has a wide range of applications in the field of life sciences. It is commonly used in various assays and experiments to study the role of ARG2 in different biological processes.
MLL antibody
MLL antibody was raised in Mouse using a purified recombinant fragment of MLL(aa3751-3968) expressed in E. coli as the immunogen.Claudin 5 antibody
The Claudin 5 antibody is a highly specialized monoclonal antibody that acts as a growth factor neutralizer. It specifically targets and inhibits the activity of hepatocyte growth factors, which are involved in various cellular processes such as cell proliferation and migration. This antibody is widely used in life sciences research to study the role of growth factors in different biological systems.IFNG antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. This active compound is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. Its bactericidal activity has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, this drug specifically targets Mycobacterium tuberculosis strains and inhibits cell growth. With its potent properties and targeted approach, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an excellent choice for combating tuberculosis infections.STYXL1 antibody
STYXL1 antibody was raised in rabbit using the middle region of STYXL1 as the immunogenKCTD9 antibody
KCTD9 antibody was raised using the middle region of KCTD9 corresponding to a region with amino acids INLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDLQEANLRGSNVKGLYAR antibody
LYAR antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQENSE antibody
The NSE antibody is a cytotoxic monoclonal antibody that has been widely used in research and clinical applications. It specifically targets the neuron-specific enolase (NSE), which is an enzyme found predominantly in neurons and neuroendocrine cells. The NSE antibody can be used for various purposes, including immunohistochemistry, Western blotting, ELISA, and flow cytometry. In research, the NSE antibody has been utilized to study microvessel density in tumors and to investigate the role of NSE in cancer progression. It has also been employed in electrophoresis techniques to identify and characterize proteins with high specificity. In clinical settings, the NSE antibody has proven valuable as a diagnostic marker for certain types of tumors, particularly those derived from neuroendocrine tissues. It can aid in the identification and classification of these tumors, providing crucial information for treatment decisions. Furthermore, the NSE antibody has shown potential therapeutic applications. By targeting NSE-expressing cells, it mayAntithrombin III antibody
Antithrombin III antibody was raised in goat using human antithrombin purified from plasma as the immunogen.NKX3.1 antibody
NKX3.1 antibody was raised in rabbit using residues 21-37 (TPSKPLTSFLIQDILRD) of human NKX3.1 as the immunogen.Destrin antibody
Destrin antibody was raised using a synthetic peptide corresponding to a region with amino acids ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEDYNC1I2 antibody
DYNC1I2 antibody was raised using the N terminal of DYNC1I2 corresponding to a region with amino acids VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHFBXO22 antibody
FBXO22 antibody was raised using the middle region of FBXO22 corresponding to a region with amino acids CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCEGMPR2 antibody
GMPR2 antibody was raised using the C terminal of GMPR2 corresponding to a region with amino acids GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV
ACP5 antibody
ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQGABRA3 antibody
GABRA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTtPA antibody
tPA antibody was raised in sheep using human tissue-type plasminogen activator prepared from melanoma cell line as the immunogen.
