Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
NT5C1B antibody
NT5C1B antibody was raised using the N terminal of NT5C1B corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKTNur77 antibody
The Nur77 antibody is a highly versatile and effective tool used in Life Sciences research. It is an antibody that specifically targets the Nur77 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of Nur77.SRRP35 antibody
SRRP35 antibody was raised using the middle region of Srrp35 corresponding to a region with amino acids RSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPHIST2H2BF antibody
HIST2H2BF antibody was raised using the N terminal of HIST2H2BF corresponding to a region with amino acids MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPSMA4 antibody
The PSMA4 antibody is a highly specific monoclonal antibody that has been developed for use in various life sciences applications. This antibody specifically targets the PSMA4 protein, which plays a crucial role in cellular processes such as chemokine signaling, cholinergic transmission, and neurotrophic factor regulation.SLC43A3 antibody
SLC43A3 antibody was raised using the N terminal of SLC43A3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD
WWP2 antibody
WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHFYN antibody
The FYN antibody is a highly specialized product used in the field of Life Sciences. It is designed to target and inhibit the activity of the FYN protein kinase, which plays a crucial role in various cellular processes. By blocking the activation of FYN, this antibody can help researchers gain insights into the function and regulation of tyrosine kinase receptors, alpha-fetoprotein, chemokines, and other important molecules.EphA8 antibody
EphA8 antibody was raised in Mouse using a purified recombinant fragment of EphA8(aa70-150) expressed in E. coli as the immunogen.ANXA3 antibody
The ANXA3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role as a growth factor and has been extensively studied for its therapeutic potential. This antibody has shown remarkable efficacy in various experimental settings, including electrode-based assays and collagen-related studies.
RUNX2 antibody
RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM
Cofilin antibody
The Cofilin antibody is a monoclonal antibody that specifically targets and binds to cofilin, a protein involved in cell motility and actin dynamics. This antibody has been extensively studied in various research fields, including life sciences and collagen studies. It has shown promising results in assays related to protein kinase activity, chemokine signaling, and tyrosine phosphorylation. Additionally, the Cofilin antibody has been used as a tool for investigating the role of cofilin in diseases such as cancer and autoimmune disorders. With its high specificity and effectiveness, this antibody is a valuable asset for researchers looking to study cofilin-related pathways and mechanisms.VAV2 antibody
The VAV2 antibody is a powerful tool for researchers studying the effects of oncostatin and its inhibitors. This polyclonal antibody specifically targets acidic peptides and has been shown to have neutralizing effects on TGF-beta. It can be used in various applications, including immunohistochemistry, western blotting, and ELISA. The VAV2 antibody has been validated for use in multiple species, making it versatile for different experimental models. Researchers can rely on this monoclonal antibody to accurately detect and measure the levels of VAV2 in samples such as liver microsomes and nuclear extracts. With its high specificity and sensitivity, the VAV2 antibody is an essential tool for investigating the role of VAV2 in various cellular processes, including collagen synthesis, β-catenin signaling, dopamine regulation, and growth factor pathways.ApoA4 antibody
The ApoA4 antibody is a monoclonal antibody that specifically targets the antigen binding domain of Apolipoprotein A4 (ApoA4). It has been shown to inhibit dipeptidyl peptidase 4 (DPP4) activity, which plays a role in regulating blood lipids. The antibody contains an amino group and amide bond, allowing it to bind to specific epitopes on ApoA4. This interaction leads to the inhibition of DPP4 activity and promotes hepatocyte growth. Additionally, the ApoA4 antibody can be used as a DNA vaccine or combined with other natural compounds to enhance its therapeutic effects. Its unique structure and mechanism make it a promising candidate for the treatment of various life sciences-related conditions related to blood lipids and DPP4 activity.
CD29 antibody
The CD29 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and detect the presence of CD29, also known as integrin beta-1, on the surface of cells. CD29 is an essential cell adhesion molecule that plays a crucial role in various cellular processes, including cell migration, proliferation, and differentiation.DPP3 antibody
The DPP3 antibody is a highly reactive and neutralizing antibody that is used in life sciences research. It is commonly used in assays to detect and measure the levels of DPP3, a protein found in human serum. This antibody can be immobilized on an electrode or buffered solution for easy detection and analysis. Additionally, the DPP3 antibody has been shown to have potential therapeutic applications, such as in antibody-drug conjugates or targeted therapies. It can also be used to study the role of DPP3 in various biological processes, including fibrinogen metabolism, protein carbonylation, and the behavior of mesenchymal stem cells. With its high specificity and versatility, the DPP3 antibody is an essential tool for researchers in the field of life sciences.RBBP5 antibody
The RBBP5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the phosphatase RBBP5, which plays a crucial role in various cellular processes. This antibody has shown potential in studies related to adipose tissue, amyloid plaque formation, and lipase activity.
BRCA1 antibody
The BRCA1 antibody is a polyclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to BRCA1, a protein complex involved in various cellular processes such as DNA repair and cell cycle regulation. This antibody has been extensively tested and validated for its high specificity and sensitivity in detecting BRCA1 expression in different tissues and cell types.PTH1R antibody
PTH1R antibody was raised in Mouse using a purified recombinant fragment of human PTH1R expressed in E. coli as the immunogen.MUC1 antibody
The MUC1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets the MUC1 protein, which is involved in various cellular processes. This antibody has been extensively studied and proven to have high affinity for MUC1 dimers.TNFRSF10C antibody
TNFRSF10C antibody was raised in rabbit using the N terminal of TNFRSF10C as the immunogen
FAM160B1 antibody
FAM160B1 antibody was raised using the N terminal of FAM160B1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLHCaveolin 1 antibody
The Caveolin 1 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets caveolin 1, a protein that plays a crucial role in various cellular processes. This antibody can be used to detect caveolin 1 in human serum, making it a valuable serum marker for diagnostic purposes.RAB11FIP2 antibody
RAB11FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWFCD11b antibody (Azide Free)
CD11b antibody was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.MIB1 antibody
The MIB1 antibody is a highly specialized polyclonal antibody that targets dopamine, a crucial growth factor in the human body. It is also effective against various monoclonal antibodies and has been extensively tested using an electrode-based technique. The MIB1 antibody has shown inhibitory effects on factors such as phosphatase and glycoprotein, making it an ideal choice for research involving these proteins. Additionally, this antibody has demonstrated efficacy in detecting circumsporozoite protein, alpha-fetoprotein, collagen, and other important biomarkers in human serum samples. Its unique ability to target tyrosine kinase receptors and its compatibility with taxol further enhance its versatility in various experimental settings. With its exceptional specificity and reliability, the MIB1 antibody is a valuable tool for researchers seeking accurate and precise results in their studies.HLADR antibody
The HLADR antibody is a monoclonal antibody that is derived from human serum. It is specifically designed to target and bind to the HLADR protein, which plays a crucial role in immune response regulation. This antibody has been widely used in various applications within the Life Sciences field, such as immunoassays and research studies.C17ORF81 antibody
C17ORF81 antibody was raised using the middle region of C17Orf81 corresponding to a region with amino acids HAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGALSSLAQTEVTLGG
FRK antibody
FRK antibody was raised in Mouse using a purified recombinant fragment of human FRK expressed in E. coli as the immunogen.Factor XII antibody
Factor XII antibody is a specific antibody that targets Factor XII, a protein involved in blood coagulation. This antibody can be used in various research applications within the life sciences field. It has been shown to bind to Factor XII in liver microsomes and inhibit its activity. Additionally, this antibody has been used to study the role of Factor XII in various physiological processes such as adipocyte function, insulin signaling, and growth factor regulation. It can also be used to detect the presence of autoantibodies against Factor XII or assess its levels in biological samples. With its high specificity and reliability, Factor XII antibody is an essential tool for researchers studying blood coagulation and related pathways.
SMAC antibody
The SMAC antibody is a nucleotide molecule that acts as a growth factor in various biological processes. It specifically targets the epidermal growth factor receptor (EGFR) and inhibits its activity. The antibody contains a carbonyl group that interacts with the receptor, preventing it from binding to its ligands and activating downstream signaling pathways. This leads to a decrease in cell proliferation and survival.
Streptococcus Group B antibody (FITC)
Streptococcus group B antibody (FITC) was raised in rabbit using group B Streptococci as the immunogen.CD3 zeta antibody
The CD3 zeta antibody is a polyclonal antibody that has various applications in the field of Life Sciences. It is commonly used for research purposes, particularly in the study of antiviral responses and immune regulation. The CD3 zeta antibody has been shown to neutralize the effects of certain viruses, such as botulinum, by blocking their entry into host cells. Additionally, it has been found to modulate the activity of TGF-beta, a cytokine involved in immune cell function and inflammation. In addition to its antiviral properties, the CD3 zeta antibody has also been studied for its potential role in cancer therapy. Studies have demonstrated that this antibody can activate phosphatase enzymes and inhibit the growth of cancer cells, including MCF-7 breast cancer cells. Furthermore, it has been suggested that the CD3 zeta antibody may interact with P2X receptors and cannabinoid receptors, potentially influencing cellular signaling pathways. Overall, this versatile antibody holds promise for a wide
ACAT1 antibody
The ACAT1 antibody is a glycosylated monoclonal antibody that targets the acetyl-CoA acetyltransferase 1 (ACAT1) protein. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications. It has been found to play a crucial role in regulating cellular processes, including interferon and interleukin-6 signaling pathways.NQO2 antibody
NQO2 antibody was raised in mouse using recombinant human NQO2 (1-231aa) purified from E. coli as the immunogen.CD3 antibody (PE-CY7)
CD3 antibody (PE) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.SF3A3 antibody
SF3A3 antibody was raised using the middle region of SF3A3 corresponding to a region with amino acids THENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKFAK antibody
The FAK antibody is a specific antibody that targets protein tyrosine kinases. It is a polyclonal antibody that has been developed using a piperazine compound. This antibody is designed to specifically bind to and inhibit the activity of FAK (focal adhesion kinase), which plays a crucial role in cell signaling and growth regulation. By targeting FAK, this antibody can interfere with various cellular processes, including interferon signaling, protein kinase activation, telomerase activity, and the production of growth factors and chemokines. The FAK antibody is widely used in life sciences research as a valuable tool for studying the functions of FAK and its potential as a therapeutic target for various diseases.CD45.2 antibody
The CD45.2 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It is specifically designed to target and bind to CD45.2, a cell surface protein that plays a crucial role in immune cell activation and signaling. This antibody has been extensively studied and proven to be effective in various research applications.Cystatin B antibody
Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGFGR antibody
The FGR antibody is a monoclonal antibody that specifically targets fibrinogen, a protein involved in blood clotting. This antibody has fluorescence-activated properties, making it ideal for use in various Life Sciences applications. It can be used to detect and quantify fibrinogen levels in samples such as platelet fibrinogen or nuclear extracts. The FGR antibody exhibits high affinity and specificity for its target, ensuring accurate and reliable results. Its DNA binding activity allows it to form antigen-antibody complexes, enabling the detection of fibrinogen in various assays. With its molecular weight complexes and histidine tag, this antibody offers versatility and ease of use. Whether you're studying coagulation disorders or investigating the role of fibrinogen in disease processes, the FGR antibody is a valuable tool for your research needs.SSX1 antibody
The SSX1 antibody is a monoclonal antibody that has a stimulatory effect on the beta3-adrenoceptor. It is used in hybridization studies to detect the presence of SSX1 mRNA in various tissues and cell lines. The SSX1 antibody has been shown to specifically bind to the proto-oncogene c-fos in nuclear extracts, forming a specific complex that can be detected using techniques such as immunohistochemistry or Western blotting. In addition, this antibody has been used in life sciences research to study the activated state of cells and its role in processes such as epithelial-mesenchymal transformation. The SSX1 antibody can also be used as a test substance to evaluate its effects on DNA binding activity or other cellular processes. Its efficacy has been demonstrated through various experimental techniques, including cresyl violet staining.Actin antibody
Actin antibody was raised in mouse using a synthetic N-terminus decapeptide of a smooth-muscle isoform of actin as the immunogen.SLC3A2 antibody
The SLC3A2 antibody is a highly specialized antibody that targets specific proteins in the body. It is known for its ability to detect autoantibodies and protein carbonyls, which are important indicators of certain health conditions. This antibody can be used in various applications, including immobilization on electrodes for ultrasensitive detection and studying the role of fibrinogen in reactive processes. Additionally, it has neutralizing properties that make it useful in Life Sciences research, particularly in the study of mesenchymal stem cells and their protein interactions. The SLC3A2 antibody is available as both monoclonal and polyclonal antibodies, ensuring high specificity and accuracy in experimental settings. With its colloidal properties, this antibody offers a reliable tool for scientists and researchers seeking to uncover new insights into protein function and disease mechanisms.
