Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
NFkB p65 antibody
The NFkB p65 antibody is a highly effective and specific monoclonal antibody that targets the NFkB p65 protein. This protein plays a crucial role in regulating various cellular processes, including inflammation, immune response, and cell survival. The NFkB p65 antibody can be used for research purposes, as well as for therapeutic applications.S100A1 antibody
S100A1 antibody was raised in Mouse using a purified recombinant fragment of S100A1 expressed in E. coli as the immunogen.CHST7 antibody
CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTRPRPF6 antibody
PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR
TCP11 antibody
TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGDNEURL2 antibody
NEURL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGVNDUFV1 antibody
NDUFV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG
CD1b antibody
The CD1b antibody is a highly effective medicament used in the field of Life Sciences. This monoclonal antibody specifically targets and binds to CD1b, a protein involved in immune responses. It has been shown to have collagen-binding properties and can also interact with other molecules such as galectin-3-binding, alpha-fetoprotein, and hyaluronic acid. The CD1b antibody is widely used in research and diagnostic applications, particularly in the study of immune system function and diseases. It can be utilized as a cytotoxic agent for targeted therapy or as an antagonist binding agent to block specific growth factors. Additionally, this antibody has shown potential for use in treating conditions like thrombocytopenia. With its versatile applications and high specificity, the CD1b antibody is a valuable tool in the field of biomedical research.PARP1 antibody
The PARP1 antibody is a highly specific monoclonal antibody that targets phosphorylcholine. It is commonly used in particle chemiluminescence assays to detect the presence of PARP1. This antibody recognizes and binds to the antigen, allowing for accurate detection and quantification of PARP1 levels. It has been extensively validated and is widely recognized as a reliable tool for studying PARP1-related processes. The PARP1 antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It exhibits high affinity and specificity towards its target and has minimal cross-reactivity with other proteins or molecules. Researchers and scientists rely on this antibody to study PARP1 function, protein-protein interactions, and cellular processes such as DNA repair. With its exceptional performance and versatility, the PARP1 antibody is an essential tool for any laboratory conducting research in the field of molecular biology or cell biology.CDC2 antibody
The CDC2 antibody is a highly specialized antibody that targets the activated form of CDC2, a protein involved in cell division and growth. This antibody is widely used in research and clinical applications to study the role of CDC2 in various biological processes. It can be used as an inhibitor to block the activity of CDC2, allowing researchers to investigate its function and potential therapeutic applications. The CDC2 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. These antibodies have been extensively tested and validated in Life Sciences research, ensuring their reliability and accuracy. Additionally, the CDC2 antibody has neutralizing capabilities, making it an ideal tool for studying the effects of CDC2 on adipose tissue growth and other cellular processes. Whether you are conducting basic research or developing new therapies, the CDC2 antibody is an essential tool for understanding the intricate mechanisms of cell division and growth regulation.
AP2M1 antibody
The AP2M1 antibody is a monoclonal antibody that specifically targets the AP2M1 protein. This protein plays a crucial role in the regulation of insulin and adiponectin signaling pathways. By binding to the AP2M1 protein, this antibody can modulate the activity of adipocytes and promote the growth factor-mediated signaling cascade.C19ORF24 antibody
C19ORF24 antibody was raised using the N terminal Of C19Orf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLPSMS antibody
The SMS antibody is a highly specialized monoclonal antibody that targets CD33, a protein found in the Life Sciences field. This antibody has been extensively studied and proven to be effective in inhibiting the activity of CD33, which plays a crucial role in various cellular processes.
PSPH antibody
The PSPH antibody is a highly specialized antibody that targets the disulfide bond in the human protein. This antibody is designed for hybridization with human serum to detect and bind to specific receptors. It is available as both monoclonal and polyclonal antibodies, ensuring high specificity and sensitivity in various applications.PRCC antibody
The PRCC antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the PRCC protein, which is involved in the development of certain cancers. This antibody can be used in various applications, such as immunohistochemistry and western blotting, to detect and quantify the expression of PRCC in tissue samples. The PRCC antibody is highly specific and binds to the amino group of the PRCC protein with high affinity. It can be conjugated with different labels, such as colloidal gold or fluorescent dyes, for visualization purposes. This antibody is commonly used in combination with other antibodies, such as anti-CD33 or anti-HER2 antibodies, to study biomolecules and their interactions. Its versatility and reliability make it an essential tool for researchers studying cancer biology and related fields.
HSP27 antibody
HSP27 antibody is a specialized antibody that targets the heat shock protein 27 (HSP27). HSP27 is a glycoprotein that plays a crucial role in cellular stress response and has been implicated in various diseases. This antibody specifically binds to HSP27, allowing for its detection and measurement in biological samples. It is commonly used in life sciences research to study the function and regulation of HSP27. The HSP27 antibody can be used in techniques such as immobilization, interferon assays, and Western blotting. Whether you need a monoclonal or polyclonal antibody, the HSP27 antibody provides a valuable tool for investigating the role of HSP27 in cellular processes and disease development.GRHPR antibody
GRHPR antibody was raised using the N terminal of GRHPR corresponding to a region with amino acids EPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDH
NTRK3 antibody
NTRK3 antibody was raised in Mouse using purified recombinant extracellular fragment of human NTRK3 (aa32-429) fused with hIgGFc tag expressed in HEK293 cells as the immunogen.
PIGA antibody
The PIGA antibody is a monoclonal antibody that has a stimulatory effect on erythropoietin production. It is used in the field of Life Sciences for research and diagnostic purposes. This antibody specifically targets PIGA, which is a glycoprotein involved in the biosynthesis of glycosylphosphatidylinositol (GPI) anchors. The PIGA antibody can be used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. It has been shown to have neutralizing and cytotoxic effects on cells expressing PIGA, making it a valuable tool for studying the function of this protein. Additionally, the PIGA antibody can be used in lectin affinity chromatography and electrophoresis experiments due to its ability to bind to specific carbohydrate residues.Calcitonin antibody
Calcitonin antibody is a growth factor that belongs to the class of monoclonal antibodies. It is a pegylated glycoprotein that specifically targets calcitonin, a hormone involved in regulating calcium levels in the body. This antibody binds to calcitonin and inhibits its activity, leading to decreased calcium levels. Calcitonin antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications. Additionally, this antibody has been used in combination with other therapeutic agents such as trastuzumab to enhance their efficacy. With its cytotoxic properties and ability to neutralize calcitonin activity, this monoclonal antibody holds great potential for further advancements in the field of medicine.14-3-3 eta antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside:
Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, the ultimate antituberculosis drug from the rifamycins class. This potent compound is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Its unique mechanism of action involves binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. With its high frequency of human activity demonstrated through patch-clamp technique on human erythrocytes, it is a reliable choice for treating tuberculosis. Additionally, this drug undergoes various metabolic transformations, ensuring optimal efficacy. Don't let tuberculosis hold you back - choose 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for a brighter future.KCTD17 antibody
KCTD17 antibody was raised using the middle region of KCTD17 corresponding to a region with amino acids YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEDDR2 antibody
DDR2 antibody was raised in Mouse using a purified recombinant fragment of human DDR2 expressed in E. coli as the immunogen.CUEDC1 antibody
CUEDC1 antibody was raised using the middle region of CUEDC1 corresponding to a region with amino acids RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE
C9ORF25 antibody
C9ORF25 antibody was raised using the middle region of C9Orf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC
PDIK1L antibody
PDIK1L antibody was raised using the middle region of PDIK1L corresponding to a region with amino acids TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPEC8orf45 antibody
C8orf45 antibody was raised using the middle region of C8orf45 corresponding to a region with amino acids IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGEMXRA5 antibody
The MXRA5 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. This antibody has the unique ability to neutralize colloidal and reactive carbamazepine, making it an essential tool for researchers studying the effects of this drug on various biological processes. Additionally, the MXRA5 antibody has been shown to have a high affinity for mesenchymal stem cells, making it an ideal choice for studies involving these cells. With its ultrasensitive detection capabilities, this antibody can accurately measure protein carbonyls and fibrinogen levels, providing valuable insights into oxidative stress and blood clotting mechanisms. Whether you're conducting research or developing diagnostic assays, the MXRA5 antibody is a reliable and versatile tool that will help you achieve accurate and meaningful results.
PHB2 antibody
The PHB2 antibody is a highly specialized antibody used in the field of Life Sciences. It targets specific proteins and molecules involved in various biological processes. This antibody has been shown to interact with interferon, β-catenin, collagen, and growth factors. It acts as a cox-2 inhibitor and has the ability to bind to nuclear β-catenin.WIPI1 antibody
WIPI1 antibody was raised using the middle region of WIPI1 corresponding to a region with amino acids LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGFLJ20433 antibody
FLJ20433 antibody was raised using the N terminal of FLJ20433 corresponding to a region with amino acids MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN
ORC2 Antibody
The ORC2 Antibody is a highly effective cation-neutralizing antibody that is widely used in the field of Life Sciences. It is specifically designed to inhibit the activity of extracellular histones and other growth factors, making it an essential tool for researchers studying cell signaling pathways and protein interactions. This antibody has been extensively tested and proven to be highly specific and sensitive, ensuring accurate and reliable results in various experimental settings. With its exceptional performance, the ORC2 Antibody is a valuable asset for any laboratory or research facility.GANP antibody
The GANP antibody is a highly versatile and effective tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody has been shown to have neutralizing properties against polymorphic antigens, making it an excellent choice for studies involving intraocular antigen-antibody reactions.CD33 Antibody
CD33 Antibody is a monoclonal antibody that specifically targets CD33, a cell surface protein expressed on myeloid cells. This antibody can be used in various applications in the field of Life Sciences. CD33 Antibody has been widely used as a cytotoxic conjugate in cancer research and therapy. It can be conjugated with cytotoxic agents to selectively deliver them to CD33-expressing cells, leading to their destruction.Myeloperoxidase antibody
Myeloperoxidase antibody was raised in Mouse using a purified recombinant fragment of MPO(aa1-193) expressed in E. coli as the immunogen.Cytochrome c antibody
The Cytochrome c antibody is a highly specific antibody that targets the cytochrome c protein. It is commonly used in life sciences research, particularly in studies involving cell signaling and apoptosis. This polyclonal antibody recognizes the cytochrome c protein in various species, including humans and mice.FAM107A antibody
FAM107A antibody was raised using the middle region of FAM107A corresponding to a region with amino acids RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEZBP1 antibody
ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNGVitronectin antibody
The Vitronectin antibody is a monoclonal antibody that specifically targets the erythropoietin receptor. This antibody has been extensively studied and proven to be highly effective in various applications. It can be used for research purposes, diagnostic assays, and therapeutic interventions.
Lamin A Antibody
The Lamin A Antibody is a highly effective cytotoxic agent used in Life Sciences research. This antibody specifically targets human hepatocytes and immobilizes them, allowing for accurate and reliable assays. It is a monoclonal antibody that binds to the antigen transthyretin, inhibiting its activity and preventing interference with experimental results. The Lamin A Antibody has been extensively tested and shown to be activated by interferon, making it an ideal tool for studying immune responses. With its high specificity and affinity for its target, this monoclonal antibody is a valuable asset in any laboratory setting.Desmoglein 1 + 2 antibody
Desmoglein 1/2 antibody was raised in mouse using “Band 3” polypeptide of isolated desmosomes from bovine muzzle epidermis as the immunogen.
Ctp Synthase antibody
Ctp Synthase antibody was raised using the C terminal of CTPS corresponding to a region with amino acids FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH
SYNCRIP antibody
SYNCRIP antibody was raised using the N terminal of SYNCRIP corresponding to a region with amino acids MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGTFF1 antibody
TFF1 antibody is a monoclonal antibody that specifically targets alpha-fetoprotein. It is commonly used in life sciences research to study the role of TFF1 in various biological processes. The antibody can be used in different applications, such as immunohistochemistry and Western blotting, to detect and quantify TFF1 levels. Additionally, TFF1 antibody can be utilized in experiments involving hydrogen fluoride polymers, antibodies immobilized on electrodes, or monolayer cultures. This versatile tool allows researchers to investigate the function of TFF1 and its interactions with other molecules, such as protein kinases or glucagon inhibitors. With its high specificity and sensitivity, the TFF1 antibody is an essential component for any study involving TFF1-related mechanisms.
DKK3 antibody
DKK3 antibody was raised in Mouse using a purified recombinant fragment of human DKK3 expressed in E. coli as the immunogen.
