Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75512 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PAK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing bacterial growth. It has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.C10orf30 antibody
C10orf30 antibody was raised using the N terminal of C10orf30 corresponding to a region with amino acids AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRSomatostatin antibody
The Somatostatin antibody is a protein that specifically targets and binds to somatostatin. It is a polyclonal antibody, meaning it is derived from multiple sources and can recognize different epitopes of the target protein. The antibody is produced through a process that involves the formation of disulfide bonds, ensuring its stability and functionality.
TCTP antibody
The TCTP antibody is a neuroprotective agent that targets tyrosine. It activates neurotrophic factors and works by binding to antibodies in Life Sciences. This antibody-drug complex can be used in electrode applications. The TCTP antibody is available in both polyclonal and monoclonal forms, allowing for specific targeting of alpha-fetoprotein and inhibitory factor. With its neurotrophic properties, the TCTP antibody has potential applications in the protection and regeneration of neurons, as well as in cardiomyocyte research.PAX3 antibody
PAX3 antibody was raised in mouse using recombinant Human Paired Box Gene 3 (Waardenburg Syndrome 1) (Pax3)
BTK antibody
The BTK antibody is a glycoprotein that specifically targets galectin-3, a biomolecule involved in various cellular processes. This monoclonal antibody is widely used in Life Sciences research and has shown promising results as a potential therapeutic agent for multidrug-resistant cancers. The BTK antibody binds to galectin-3, inhibiting its function and disrupting signaling pathways associated with cell growth and survival. Additionally, this antibody has been found to enhance the activity of interferon-gamma (IFN-gamma), an important immune regulator. By targeting galectin-3 and modulating IFN-gamma signaling, the BTK antibody holds great potential as a novel family kinase inhibitor and may contribute to the development of innovative treatments for cancer and other diseases involving aberrant protein expression.RPA2 antibody
The RPA2 antibody is a monoclonal antibody that targets the chemokine receptor RPA2. It is commonly used in research and life sciences applications to study various cellular processes. This antibody specifically binds to RPA2, which plays a crucial role in cell migration, angiogenesis, and immune response. The RPA2 antibody can be used for immunohistochemistry, western blotting, flow cytometry, and other experimental techniques. With its high specificity and sensitivity, this antibody allows for accurate detection and analysis of RPA2 expression levels in different cell types and tissues. Whether you're studying helicobacter infection or investigating endothelial growth factors, the RPA2 antibody is an invaluable tool for your research needs. Trust this reliable monoclonal antibody to provide accurate results and help advance your scientific discoveries.MMP3 antibody
MMP3 antibody was raised in mouse using human pro-MMP-3 from the conditioned media of rheumatoid synovial fibroblasts as the immunogen.PARP11 antibody
PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD
RAD54 antibody
The RAD54 antibody is a potent antitumor agent that binds to specific receptors on tumor cells, leading to their destruction. It has been shown to have strong cytotoxic effects and can induce cell death in a targeted manner. The antibody's antigen binding domain specifically recognizes and binds to certain molecules present on tumor cells, triggering an immune response against them. This monoclonal antibody, developed in the field of Life Sciences, contains specific amino acid residues that enhance its efficacy and specificity. In preclinical studies, the RAD54 antibody has demonstrated the ability to inhibit angiogenesis by reducing microvessel density and suppressing endothelial growth factors. Its potential applications in cancer therapy make it a promising candidate for further research and development.PIAS1 antibody
The PIAS1 antibody is a highly specialized protein used in Life Sciences. It belongs to the class of monoclonal antibodies and polyclonal antibodies that are widely used in research and medical applications. This antibody specifically targets adalimumab, a medication used to treat conditions related to tumor necrosis factor-α (TNF-α) such as rheumatoid arthritis and Crohn's disease.TWIST antibody
The TWIST antibody is a growth factor that is commonly used in immunoassays and research in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and specifically targets epidermal growth factor (EGF). The TWIST antibody has been extensively studied and its binding characteristics have been analyzed using molecular docking techniques. It has been found to interact with cations, such as human serum albumin, and fatty acids. This antibody is widely used in various applications, including the detection and quantification of specific proteins in biological samples, as well as in studies involving serum albumin. Both monoclonal and polyclonal versions of the TWIST antibody are available, providing researchers with options depending on their specific experimental needs.beta 2 Microglobulin antibody
The beta 2 Microglobulin antibody is a mouse monoclonal antibody that specifically targets and binds to beta 2 Microglobulin, a protein found on the surface of cells. This antibody is widely used in Life Sciences research for various applications, including antigen-antibody reactions, inhibition curves, and neutralizing assays.NGAL antibody
The NGAL antibody is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is an important biomarker in various Life Sciences research areas and has been implicated in several pathological conditions. This antibody recognizes NGAL through its unique binding sites and can be used for various applications, including immunohistochemistry, ELISA, Western blotting, and flow cytometry.ADHFE1 antibody
ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS
EDC4 antibody
EDC4 antibody was raised using the N terminal of EDC4 corresponding to a region with amino acids LQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPV
Fibrinogen Alpha antibody
Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSBCL7A antibody
BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
OLFML2A antibody
OLFML2A antibody was raised using the N terminal of OLFML2A corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS
Factor B antibody
Factor B antibody was raised in Mouse using purified Factor B from human blood as the immunogen.Collagen Type IV antibody
Collagen type IV antibody was raised in mouse using human placental type IV collagen as the immunogen.Filamin A antibody
The Filamin A antibody is a monoclonal antibody used in Life Sciences research. It plays a crucial role in endocytic uptake and has neutralizing properties. This antibody specifically targets filamin A, a protein that interacts with collagen and is involved in various cellular processes. The Filamin A antibody can be used in bioassays to study the function of filamin A and its interactions with other molecules. Additionally, this antibody has cytotoxic effects on certain cell types, making it a valuable tool for investigating cellular responses. Whether you're studying interferon signaling or exploring the mechanisms of Bacillus thuringiensis activation, the Filamin A antibody is an essential component of your research toolkit. Choose this high-quality monoclonal antibody for reliable and reproducible results in your experiments.RASGRP2 antibody
The RASGRP2 antibody is a monoclonal antibody that targets the RAS guanine nucleotide-releasing protein 2 (RASGRP2). This protein is involved in signal transduction pathways and plays a crucial role in various cellular processes. The RASGRP2 antibody specifically recognizes and binds to RASGRP2, allowing for the detection and analysis of this protein in biological samples.
C3ORF62 antibody
C3ORF62 antibody was raised using the middle region of C3Orf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKAFRK antibody
FRK antibody was raised in Mouse using a purified recombinant fragment of FRK(aa2-300) expressed in E. coli as the immunogen.IRS1 antibody
The IRS1 antibody is a neutralizing polyclonal antibody that targets the circumsporozoite protein. It has been shown to have anti-VEGF (vascular endothelial growth factor) activity, making it a valuable tool in life sciences research. This antibody has also demonstrated efficacy in inhibiting the growth of various cancer cells, including MCF-7 and HER2-positive breast cancer cells, when used in combination with other targeted therapies such as trastuzumab. Additionally, the IRS1 antibody has potential applications in immunotherapy, as it can enhance the immune response by targeting specific growth factors and receptors. Its cytotoxic properties make it a promising candidate for targeted therapies against diseases such as leukemia, as it specifically targets CD33-expressing cells. Furthermore, this antibody has shown potential in promoting wound healing and tissue regeneration by stimulating keratinocyte growth. Overall, the IRS1 antibody is a versatile tool for researchers and clinicians alike, with its ability to target specific proteins and modulatePAR4 antibody
The PAR4 antibody is a highly effective monoclonal antibody that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. This antibody has been extensively studied and proven to be highly specific in its binding to alpha-synuclein. It can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA.
CD4 antibody (Spectral Red)
CD4 antibody (Spectral Red) was raised in mouse using human CD4 as the immunoge.Haptoglobin antibody
The Haptoglobin antibody is a highly specialized monoclonal antibody that targets haptoglobin, a glycoprotein found in human serum. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.MBL2 antibody
MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGRP78 antibody
The GRP78 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly used as an anti-HER2 antibody, specifically targeting the HER2 protein. This monoclonal antibody has been extensively studied and has shown promising results in combination with other therapies such as trastuzumab.CD7 antibody
CD7 antibody is a monoclonal antibody that specifically targets the CD7 protein. CD7 is a transmembrane protein that is expressed on the surface of T cells and natural killer (NK) cells. This antibody binds to CD7 and activates various signaling pathways, leading to the inhibition of cell proliferation and induction of apoptosis in cancer cells.VEGF antibody
VEGF antibody was raised in rabbit using highly pure recombinant hVEGF (human VEGF) as the immunogen.Cytokeratin Pan antibody
Cytokeratin Pan antibody was raised in Mouse using a purified recombinant fragment of CK5 expressed in E. coli as the immunogen.TRIM60 antibody
TRIM60 antibody was raised using the N terminal of TRIM60 corresponding to a region with amino acids LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLFPan Cytokeratin Antibody
The Pan Cytokeratin Antibody is a highly specialized product in the field of Life Sciences. It is a pegylated monoclonal antibody that targets cytokeratins, which are intermediate filaments found in epithelial cells. This antibody specifically recognizes various types of cytokeratins and can be used for immunohistochemistry and other related applications.C17ORF82 antibody
C17ORF82 antibody was raised using the N terminal Of C17Orf82 corresponding to a region with amino acids MGRPLEGQPLRALDLYPEPAFLRSGKDPKSSPASSPSFAVLGPEVRSTGG
Caspase 8 antibody
The Caspase 8 antibody is a highly specific monoclonal antibody that targets the caspase 8 protein. This protein plays a crucial role in apoptosis, the programmed cell death process. The antibody has been extensively studied and validated in Life Sciences research for its ability to detect and quantify caspase 8 levels.CD51 antibody
The CD51 antibody is a monoclonal antibody that targets the CD51 protein, also known as integrin alpha V. This protein plays a crucial role in cell adhesion and signaling pathways. The CD51 antibody has been shown to inhibit the activity of phosphatase, which is involved in various cellular processes including cell growth and differentiation.OATP2 antibody
OATP2 antibody was raised in mouse using synthetic C-terminus (21 aa) of human organic anion transporter SLC21A6 coupled to KLH as the immunogen.
