Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75512 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
NR3C1 antibody
NR3C1 antibody was raised in rabbit using the N terminal of NR3C1 as the immunogenPurity:Min. 95%BCL2 antibody
The BCL2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the BCL2 protein, which plays a crucial role in regulating cell survival and apoptosis. By binding to BCL2, this antibody effectively inhibits its function and prevents abnormal cell growth and proliferation.Purity:Min. 95%NEURL2 antibody
NEURL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA
Purity:Min. 95%AGK antibody
AGK antibody was raised in rabbit using the N terminal of AGK as the immunogenPurity:Min. 95%HAS3 antibody
HAS3 antibody was raised using the N terminal of HAS3 corresponding to a region with amino acids GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDPurity:Min. 95%Dcdc2a antibody
Dcdc2a antibody was raised in rabbit using the N terminal of Dcdc2a as the immunogenPurity:Min. 95%OR13C5 antibody
OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogenPurity:Min. 95%SDCBP antibody
SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVPurity:Min. 95%STYK1 antibody
STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIPurity:Min. 95%ARMCX3 antibody
ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEPurity:Min. 95%CDC4 (69kDa) antibody
CDC4 (69kDa) antibody was raised in rabbit using N terminus of the 69 kDa isoform of the hCdc4 protein as the immunogen.Purity:Min. 95%PCDH12 antibody
PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVTPurity:Min. 95%Junctophilin 1 antibody
Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPPurity:Min. 95%AADACL4 antibody
AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHGPurity:Min. 95%PRELP antibody
PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSHPurity:Min. 95%DNASE2B antibody
DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
Purity:Min. 95%SMYD1 antibody
SMYD1 antibody was raised in rabbit using the N terminal of SMYD1 as the immunogenPurity:Min. 95%AK3 antibody
AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT
Purity:Min. 95%NLK antibody
NLK antibody was raised in rabbit using the middle region of NLK as the immunogenPurity:Min. 95%DLG3 antibody
DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGPurity:Min. 95%SLC6A3 antibody
SLC6A3 antibody was raised in rabbit using the N terminal of SLC6A3 as the immunogenPurity:Min. 95%BCL10 antibody
BCL10 antibody was raised in rabbit using C terminal sequence [EMFLPLRSRTVSRQC] of Bcl10 as the immunogen.
Purity:Min. 95%MIP1 alpha antibody
MIP1 alpha antibody was raised in rabbit using highly pure recombinant rat MIP1 alpha as the immunogen.
Purity:Min. 95%FGFR1 antibody
The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.
Purity:Min. 95%Dopamine D3 Receptor antibody
Dopamine D3 receptor antibody was raised in rabbit using a 19 amino acid peptide of human D3R as the immunogen.Purity:Min. 95%ALDH6A1 antibody
ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDPurity:Min. 95%TMEFF1 antibody
TMEFF1 antibody was raised using the middle region of TMEFF1 corresponding to a region with amino acids YSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDPurity:Min. 95%SMC4 antibody
SMC4 antibody was raised using the N terminal of SMC4 corresponding to a region with amino acids SGRTESPATAAETASEELDNRSLEEILNSIPPPPPPAMTNEAGAPRLMITPurity:Min. 95%USP3 antibody
USP3 antibody was raised in rabbit using the N terminal of USP3 as the immunogenPurity:Min. 95%LTC4S antibody
LTC4S antibody was raised in rabbit using the N terminal of LTC4S as the immunogenPurity:Min. 95%RANBP5 antibody
RANBP5 antibody was raised in rabbit using the N terminal of RANBP5 as the immunogen
Purity:Min. 95%OR1S1 antibody
OR1S1 antibody was raised in rabbit using the C terminal of OR1S1 as the immunogen
Purity:Min. 95%Pitx1 antibody
Pitx1 antibody was raised in rabbit using the middle region of Pitx1 as the immunogenPurity:Min. 95%LDOC1 antibody
LDOC1 antibody was raised in rabbit using the N terminal of LDOC1 as the immunogenPurity:Min. 95%FMO4 antibody
FMO4 antibody was raised using the N terminal of FMO4 corresponding to a region with amino acids MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLGPurity:Min. 95%SERPINE1 antibody
SERPINE1 antibody was raised in rabbit using the N terminal of SERPINE1 as the immunogenPurity:Min. 95%ATG9B antibody
ATG9B antibody was raised in rabbit using the C terminal of ATG9B as the immunogenPurity:Min. 95%CST8 antibody
CST8 antibody was raised in rabbit using the N terminal of CST8 as the immunogenPurity:Min. 95%CYP3A7 antibody
CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSGPurity:Min. 95%VIP antibody
VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEPurity:Min. 95%ZNF17 antibody
ZNF17 antibody was raised in rabbit using the N terminal of ZNF17 as the immunogenPurity:Min. 95%PAR4 antibody
PAR4 antibody was raised in rabbit using human par-4 protein# as the immunogen.Purity:Min. 95%HAVCR2 antibody
HAVCR2 antibody was raised in rabbit using the C terminal of HAVCR2 as the immunogen
Purity:Min. 95%CA2 antibody
CA2 antibody was raised in rabbit using the N terminal of CA2 as the immunogenPurity:Min. 95%CD56 antibody
CD56 antibody is a monoclonal antibody that specifically targets CD56, a cell surface protein found on various immune cells. This antibody can be used in immunohistochemistry and flow cytometry to detect and quantify CD56 expression. It is commonly used in research and diagnostic applications related to the study of immune cell function and diseases such as cancer. CD56 antibody works by binding to the CD56 protein, allowing for visualization and analysis of CD56-positive cells. It is highly specific and sensitive, making it a valuable tool in life sciences research.
Purity:Min. 95%HEY1 antibody
HEY1 antibody was raised using the middle region of HEY1 corresponding to a region with amino acids HQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPurity:Min. 95%FBG5 antibody
FBG5 antibody was raised in rabbit using residues 163-175 (KKQVLDLEEEGLW) of the human FBG5 protein as the immunogen.Purity:Min. 95%Serotonin receptor 3E antibody
Serotonin receptor 3E antibody was raised using a synthetic peptide corresponding to a region with amino acids RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPurity:Min. 95%Rerg antibody
Rerg antibody was raised in rabbit using the middle region of Rerg as the immunogenPurity:Min. 95%PTGDS antibody
PTGDS antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASPurity:Min. 95%B4galt6 antibody
B4galt6 antibody was raised in rabbit using the C terminal of B4galt6 as the immunogenPurity:Min. 95%BARD1 antibody
The BARD1 antibody is a highly specialized product in the field of Life Sciences. It plays a crucial role in various cellular processes, including fatty acid metabolism and insulin signaling. This monoclonal antibody has been extensively studied and proven to be effective in neutralizing VEGF (vascular endothelial growth factor), a protein involved in angiogenesis.Purity:Min. 95%CRMP1 antibody
CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV
Purity:Min. 95%C1orf216 antibody
C1orf216 antibody was raised in rabbit using the N terminal of C1orf216 as the immunogenPurity:Min. 95%CD131 antibody
The CD131 antibody is a monoclonal antibody that targets the chemokine receptor CD131. It has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. The CD131 antibody has been found to be effective in inhibiting the growth and migration of cancer cells, particularly in breast cancer cell lines such as MCF-7. It has also been shown to modulate the expression of E-cadherin, a protein involved in cell adhesion and tumor progression.Purity:Min. 95%ZNF582 antibody
ZNF582 antibody was raised in rabbit using the N terminal of ZNF582 as the immunogenPurity:Min. 95%ZNF41 antibody
ZNF41 antibody was raised in rabbit using the C terminal of ZNF41 as the immunogenPurity:Min. 95%POGZ antibody
POGZ antibody was raised in rabbit using the middle region of POGZ as the immunogenPurity:Min. 95%CA5A antibody
CA5A antibody was raised in rabbit using the C terminal of CA5A as the immunogenPurity:Min. 95%TMEM38B antibody
TMEM38B antibody was raised using the C terminal of TMEM38B corresponding to a region with amino acids WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNEPurity:Min. 95%SMYD1 antibody
SMYD1 antibody was raised in rabbit using the middle region of SMYD1 as the immunogen
Purity:Min. 95%PNPLA4 antibody
PNPLA4 antibody was raised using the C terminal of PNPLA4 corresponding to a region with amino acids SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMPurity:Min. 95%PTDSS2 antibody
PTDSS2 antibody was raised in rabbit using the middle region of PTDSS2 as the immunogenPurity:Min. 95%Glycoprotein 2 antibody
Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVESPurity:Min. 95%LOC653428 antibody
LOC653428 antibody was raised in rabbit using the C terminal of LOC653428 as the immunogenPurity:Min. 95%CTCFL antibody
CTCFL antibody was raised in rabbit using the N terminal of CTCFL as the immunogenPurity:Min. 95%C6ORF64 antibody
C6ORF64 antibody was raised using the C terminal Of C6Orf64 corresponding to a region with amino acids MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGRPurity:Min. 95%SLC25A20 antibody
SLC25A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWPurity:Min. 95%POLR2B antibody
POLR2B antibody was raised in rabbit using the middle region of POLR2B as the immunogenPurity:Min. 95%MIP1 beta antibody
MIP1 beta antibody was raised in rabbit using highly pure recombinant murine MIP-1beta as the immunogen.Purity:Min. 95%TMEM82 antibody
TMEM82 antibody was raised using the N terminal of TMEM82 corresponding to a region with amino acids LETVHLAGLALFLTVVGSRVAALVVLEFSLRAVSTLLSLGKGSQGAAERLPurity:Min. 95%SDF4 antibody
SDF4 antibody was raised using the middle region of SDF4 corresponding to a region with amino acids KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEEPurity:Min. 95%ZDHHC17 antibody
ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids LFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKPPurity:Min. 95%UTP18 antibody
UTP18 antibody was raised in rabbit using the N terminal of UTP18 as the immunogenPurity:Min. 95%HGF antibody
HGF antibody was raised in rabbit using the middle region of HGF as the immunogenPurity:Min. 95%CDS1 antibody
CDS1 antibody was raised in rabbit using the N terminal of CDS1 as the immunogen
Purity:Min. 95%Pura antibody
Pura antibody was raised in rabbit using the C terminal of Pura as the immunogen
Purity:Min. 95%BTNL3 antibody
BTNL3 antibody was raised using the N terminal of BTNL3 corresponding to a region with amino acids EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI
Purity:Min. 95%ENPP6 antibody
ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSPurity:Min. 95%ZNF256 antibody
ZNF256 antibody was raised in rabbit using the N terminal of ZNF256 as the immunogenPurity:Min. 95%OR2H2 antibody
OR2H2 antibody was raised in rabbit using the C terminal of OR2H2 as the immunogenPurity:Min. 95%FAM19A3 antibody
FAM19A3 antibody was raised using the middle region of FAM19A3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGVPurity:Min. 95%NETO1 antibody
NETO1 antibody was raised in rabbit using the C terminal of NETO1 as the immunogen
Purity:Min. 95%RANK Receptor antibody
RANK receptor antibody was raised in rabbit using highly pure recombinant human sRANK Receptor as the immunogen.
Purity:Min. 95%B3GALTL antibody
B3GALTL antibody was raised using the middle region of B3GALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREEPurity:Min. 95%TBL3 antibody
TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILPurity:Min. 95%APBB2 antibody
APBB2 antibody was raised using the middle region of APBB2 corresponding to a region with amino acids QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVSPurity:Min. 95%SSTR1 antibody
SSTR1 antibody was raised in rabbit using the C terminal of SSTR1 as the immunogen
Purity:Min. 95%ZNF499 antibody
ZNF499 antibody was raised in rabbit using the middle region of ZNF499 as the immunogenPurity:Min. 95%TFPI2 antibody
TFPI2 antibody was raised using the middle region of TFPI2 corresponding to a region with amino acids NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTPurity:Min. 95%ZNF326 antibody
ZNF326 antibody was raised in rabbit using the N terminal of ZNF326 as the immunogenPurity:Min. 95%Ccdc90b antibody
Ccdc90b antibody was raised in rabbit using the N terminal of Ccdc90b as the immunogen
Purity:Min. 95%HERC5 antibody
HERC5 antibody was raised using the middle region of HERC5 corresponding to a region with amino acids FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLPurity:Min. 95%Olfm3 antibody
Olfm3 antibody was raised in rabbit using the C terminal of Olfm3 as the immunogenPurity:Min. 95%
