Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75560 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
HIV1 p17 Antibody
Mouse monoclonal HIV1 p17 Antibody; immunogen Bacterially expressed, hexahistidine amino-terminal tagged HIV-1 p17 Gag protein (clade B, HXB-3 isolate).Fentanyl Antibody
The Fentanyl Antibody is a highly specialized product used in Life Sciences research. It is designed to detect and quantify fentanyl, a potent synthetic opioid, in various samples. The antibody is immobilized on magnetic particles, allowing for easy separation and purification of fentanyl from complex matrices. This product is commonly used in immunoassays, where it can be utilized for the development of diagnostic tests or screening assays.Transglutaminase 2 antibody
The Transglutaminase 2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to transglutaminase 2, an enzyme that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be reactive against transglutaminase 2 in a variety of bioassays.Progesterone Receptor antibody
The Progesterone Receptor antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the progesterone receptor, a protein involved in various cellular processes. It can be used to study the role of progesterone signaling in development, reproduction, and cancer.α 2 Antiplasmin antibody
Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.CDC23 antibody
CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEAGPR161 antibody
GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVSTK38L antibody
STK38L antibody was raised using the middle region of STK38L corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKDEDD antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known for its exceptional efficacy in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, which hinders transcription and replication processes. Extensive research has shown its high affinity towards human erythrocytes using the patch-clamp technique. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.
UXT antibody
UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLMKK4 antibody
The MKK4 antibody is a highly specific monoclonal antibody that is widely used in the field of Life Sciences. It has been extensively studied and proven to be effective in various research applications. The antibody is designed to target and bind to MKK4, a protein involved in signal transduction pathways.Progesterone Receptor Antibody
The Progesterone Receptor Antibody is a highly reactive monoclonal antibody that specifically targets the progesterone receptor. It can be used for various applications, including research and diagnostic purposes. The antibody binds to the progesterone receptor with high affinity, allowing for accurate detection and quantification of the receptor in samples.G6PD antibody
G6PD antibody was raised using the middle region of G6PD corresponding to a region with amino acids VTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIATP6V1B1 antibody
The ATP6V1B1 antibody is a glycopeptide that acts as an anti-connexin agent. It belongs to the group of polyclonal antibodies and has colloidal properties. This antibody is capable of neutralizing estrogen receptors and hormone peptides, making it useful in various applications within the field of Life Sciences. Additionally, the ATP6V1B1 antibody has neuroprotective properties and plays a role in glycan and glycosylation processes. It is important to note that this antibody should be handled with care, as it may have teratogenic effects. With its high specificity and effectiveness, the ATP6V1B1 antibody is an invaluable tool for researchers and scientists working in the field of peptide agents. Both its monoclonal and polyclonal forms are available, providing flexibility for different experimental needs.CD326 antibody
The CD326 antibody is a monoclonal antibody that specifically targets the epidermal growth factor protein. It is commonly used in Life Sciences research to study the role of this protein in various cellular processes. This antibody can be used for applications such as Western blotting, immunohistochemistry, and flow cytometry.
ApoH antibody
ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGClostridium difficile Toxin A antibody
Clostridium difficile Toxin A antibody is an active agent that specifically targets Clostridium difficile, a bacterium responsible for causing severe gastrointestinal infections. This antibody has a high affinity for the toxin produced by the bacteria and can effectively neutralize its harmful effects. The low density of this antibody allows for easy penetration into infected cells, where it can bind to and inhibit the activity of the toxin.JIP3 antibody
The JIP3 antibody is a highly effective and versatile tool used in various assays and research studies in the field of Life Sciences. This antibody specifically targets chloride, anti-mesothelin, telomerase, and other glycoproteins, making it an essential component for the detection and analysis of these markers. With its high-flux binding capabilities, this antibody ensures accurate and reliable results in serum marker analysis.DNA PKcs antibody
The DNA PKcs antibody is a highly specialized polyclonal antibody that targets the DNA-dependent protein kinase catalytic subunit (DNA PKcs). It is commonly used in research and laboratory settings to study various cellular processes involving DNA repair, recombination, and transcription. This antibody specifically recognizes and binds to the DNA PKcs protein, allowing researchers to investigate its role in different biological pathways.GTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHCDH2 antibody
The CDH2 antibody is a monoclonal antibody that targets the CDH2 protein expressed in various tissues, including rat liver microsomes. This antibody is widely used in Life Sciences research to study the role of CDH2 in different biological processes. It has been shown to have cholinergic and catecholaminergic properties, affecting neurotransmitter release and signaling pathways. Additionally, the CDH2 antibody has been found to modulate the expression of interleukin-6 and dopamine in rat liver microsomes. Its binding to the CDH2 protein leads to lysis of target cells and inhibition of cellular functions. Researchers also utilize this antibody to detect the presence of CDH2 in samples using techniques like immunofluorescence or Western blotting. The CDH2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs.Apolipoprotein E antibody
The Apolipoprotein E antibody is a polyclonal antibody that specifically targets the colony-stimulating factor (CSF) Apolipoprotein E. This antibody has been shown to have neutralizing effects on the toxic effects of CSF, making it a valuable tool for research in the field of immunology. It has also been shown to inhibit the activity of alpha-fetoprotein and family kinase inhibitor, further highlighting its versatility in various applications. The Apolipoprotein E antibody can be used in immunoassays such as ELISA or Western blotting to detect and quantify the presence of this protein in biological samples. With its high specificity and affinity, this monoclonal antibody is an essential tool for researchers studying the role of Apolipoprotein E in various physiological processes.PR6 antibody
The PR6 antibody is a highly specialized monoclonal antibody with unique characteristics. It has been extensively studied for its hybridization capabilities and its ability to bind to the amino-terminal region of specific proteins. This antibody exhibits high viscosity, making it ideal for use in assays that require increased sensitivity.Neuropilin 1 antibody
The Neuropilin 1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the neuropilin 1 molecule, which plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.CSTF2 antibody
CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAKLHL12 antibody
KLHL12 antibody was raised in Mouse using a purified recombinant fragment of human KLHL12 expressed in E. coli as the immunogen.TGF beta1 Antibody
The TGF beta1 Antibody is a highly specialized antibody that targets the transforming growth factor beta 1 (TGF-β1), a key protein involved in various biological processes. This antibody has been extensively researched and is widely used in Life Sciences for its ability to neutralize the effects of TGF-β1.Synapsin 1 antibody
The Synapsin 1 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to Synapsin 1, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. This antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA.FAM81A antibody
FAM81A antibody was raised using the N terminal of FAM81A corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTCyclin B1 antibody
The Cyclin B1 antibody is a highly specific monoclonal antibody that targets the virus surface antigen, influenza hemagglutinin. It is widely used in Life Sciences research to study the role of cyclin B1 in cell cycle regulation and cellular processes. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. The Cyclin B1 antibody has been shown to have high affinity and specificity for its target, making it an excellent tool for researchers studying cell division and proliferation. Additionally, this antibody has neutralizing activity against certain strains of influenza virus, making it a potential therapeutic candidate for antiviral treatments. With its exceptional performance and versatility, the Cyclin B1 antibody is a valuable asset in any laboratory setting.UBE2I antibody
UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG
p63 antibody
The p63 antibody is a cytotoxic agent that belongs to the class of antibodies used in Life Sciences. It is activated upon binding to its target antigen and has been shown to be effective in various research applications. The p63 antibody can be used for immunohistochemistry studies to detect the presence and localization of specific proteins or markers in tissue samples. It can also be used as a tool for protein analysis, such as Western blotting or ELISA assays. The p63 antibody has been used in studies involving alpha-fetoprotein, sclerostin, and phosphatase, among others. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific experimental needs. With its high specificity and sensitivity, the p63 antibody is a valuable tool for researchers in the field of Life Sciences.CXCL10 antibody
The CXCL10 antibody is a highly specialized antibody that has a wide range of applications in the field of Life Sciences. It has been extensively studied for its inhibitory and neutralizing effects on insulin-like growth factor-I (IGF-I) and CXCL13, which are important factors in various biological processes. This antibody has been shown to have anti-angiogenic and anti-fibrotic effects, making it a potential therapeutic option for conditions such as cancer and fibrosis. Additionally, the CXCL10 antibody has been found to have a chemotactic effect on mesenchymal stem cells, further highlighting its versatility in different research areas. This antibody is available as a polyclonal antibody and can be used as a control antibody in various experimental settings.ALDH2 antibody
The ALDH2 antibody is a monoclonal antibody used in Life Sciences research. It has been shown to effectively neutralize ALDH2 activity, which is essential for the metabolism of ethanol and other aldehydes. This antibody can be used in various applications such as lysis and electrode-based assays to study the role of ALDH2 in different biological processes.nNOS antibody
The nNOS antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.
SIRT5 antibody
The SIRT5 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and is known for its high affinity to chloride. This antibody is commonly used in research studies that focus on identifying high-flux inhibitors and serum markers. Additionally, it has been found to interact with non-coding RNA extracts, making it an essential tool for studying these substances.
SPARC antibody
The SPARC antibody is a highly specialized nuclear antibody that is widely used in the field of Life Sciences. It specifically targets collagen and serves as an electrode for various research applications. Additionally, this antibody has neutralizing properties and can effectively bind to alpha-fetoprotein, making it a valuable tool in cancer research. The SPARC antibody is a monoclonal antibody that also exhibits anti-mesothelin activity and can be used as an antiviral agent. It is commonly employed in the development of inhibitors and therapeutic antibodies. This product is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The SPARC antibody is activated upon interaction with human serum, allowing for precise detection and analysis of growth factors.CCDC146 antibody
CCDC146 antibody was raised using the middle region of CCDC146 corresponding to a region with amino acids KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA
