Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RAD18 antibody
The RAD18 antibody is a highly specific monoclonal antibody that targets the RAD18 protein. It has been widely used in Life Sciences research and diagnostics. This antibody is derived from mouse monoclonal antibodies and has been extensively characterized for its biophysical properties. The RAD18 antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry. It has shown high affinity and specificity for the target protein in human serum samples. Additionally, this antibody has been utilized in studies involving botulinum toxin research, phosphatase activity assays, and adeno-associated virus-mediated gene delivery. Its ability to bind to the cytosolic protein RAD18 makes it an invaluable tool for researchers working in the field of DNA repair and replication. Whether you're studying cell signaling pathways or investigating disease mechanisms, the RAD18 antibody is an essential reagent to have in your lab arsenal.GLUD2 antibody
GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARNOB1 antibody
NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI
Elk1 antibody
The Elk1 antibody is a monoclonal antibody that targets the Elk1 protein, which plays a crucial role in midbrain dopaminergic function. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.SLC12A1 antibody
SLC12A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Clusterin-Like 1 antibody
Clusterin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAESUSP36 antibody
USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRVANKRD54 antibody
ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDKYNU antibody
KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPMICA antibody
MICA antibody was raised using the middle region of MICA corresponding to a region with amino acids LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTMKK3 antibody
The MKK3 antibody is a highly specialized monoclonal antibody that targets the phosphatase MKK3. This antibody has been extensively studied for its role in various cellular processes, including the activation of endonucleases, regulation of β-catenin, and modulation of mitogen-activated protein (MAP) pathways. It has also been shown to interact with caspase-9, a key protein involved in apoptosis.SLFN12 antibody
SLFN12 antibody was raised using the middle region of SLFN12 corresponding to a region with amino acids KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL
MUC1 antibody
MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN53BP1 antibody
The 53BP1 antibody is a highly specific and potent monoclonal antibody that is used for various applications in research and diagnostics. This antibody binds to the macrophage-derived chemokine, neutralizing its activity and preventing its interaction with its receptor, C-C chemokine receptor. By blocking this interaction, the 53BP1 antibody can inhibit the recruitment of immune cells to the site of inflammation, providing a potential therapeutic benefit.RPS27L antibody
RPS27L antibody was raised using the N terminal of RPS27L corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHANOLC1 antibody
NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
VDR antibody
VDR antibody was raised using the N terminal of VDR corresponding to a region with amino acids ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP
HSV1 antibody (biotin)
HSV1 antibody (biotin) was raised in goat using HSV type 1, strain F as the immunogen.Fibrinogen antibody (HRP)
Fibrinogen antibody (HRP) was raised in sheep using human Fibrinogen purified from plasma as the immunogen.HDAC8 antibody
The HDAC8 antibody is a highly specialized polyclonal antibody that specifically targets the human protein HDAC8. This antibody has been extensively tested and validated for its ability to detect and bind to HDAC8 in various experimental conditions. It is commonly used in research settings to study the role of HDAC8 in various cellular processes.SIRT5 antibody
SIRT5 antibody was raised using the C terminal of SIRT5 corresponding to a region with amino acids HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS
Laminin antibody (biotin)
Laminin antibody (biotin) was raised in rabbit using non-reduced 400 kDa human laminin as the immunogen.CD49b antibody
CD49b antibody was raised in mouse using human CD49b as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD11b antibody (Azide Free)
CD11b antibody (Azide Free) was raised in rat using C57BL/10 murine splenic T cells and concanavalin A-activated C57BL/10 splenocytes as the immunogen.
CD44 antibody (biotin)
CD44 antibody (biotin) was raised in rat using murine CD44 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD45R antibody (Spectral Red)
CD45R antibody (PE-CY5.5) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD31 antibody (FITC)
CD31 antibody (FITC) was raised in rat using murine leukocyte cell line 32D as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD16 antibody (PE-CY7)
CD16 antibody (PE-CY7) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)
Purity:Min. 95%Molecular weight:0 g/molCD19 antibody (CY5)
CD19 antibody (CY5) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD19 antibody (PE)
CD19 antibody (PE) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD19 antibody (FITC)
CD19 antibody (FITC) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD11a antibody (PE-CY7)
CD11a antibody (PE-CY7) was raised in rat using murine CD11a (LFA-1a) as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD3e antibody (PE)
CD3e antibody (PE) was raised in mouse using porcine CD3e as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD32 antibody (PE)
CD32 antibody (PE) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.Purity:Min. 95%Molecular weight:0 g/molStreptococcus Group A antibody (HRP)
Streptococcus group A antibody (HRP) was raised in goat using group A streptococci as the immunogen.CD44 antibody (Allophycocyanin)
CD44 antibody (Allophycocyanin) was raised in mouse using chicken CD44 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD16 antibody (PE-CY7)
CD16 antibody (PE) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)Purity:Min. 95%Molecular weight:0 g/molCD45 antibody (biotin)
CD45 antibody (biotin) was raised in Rat using CD45/LCA as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD25 antibody (FITC)
CD25 antibody (FITC) was raised in rat using IL-2-dependent BALB/c murine helper T-cell clone HT-2 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD45RB antibody
CD45RB antibody was raised in rat using cloned mouse Th2 cell lines as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD18 antibody (FITC)
CD18 antibody (FITC) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD38 antibody (biotin)
CD38 antibody (biotin) was raised in rat using CD38 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD152 antibody (PE)
CD152 antibody (FITC) was raised in hamster using murine CD152/CTLA-4 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD117 antibody (Spectral Red)
CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD19 antibody (biotin)
CD19 antibody (biotin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD25 antibody (Spectral Red)
CD25 antibody (Spectral Red) was raised in rat using alpha chain IL-2 receptor as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD19 antibody (PE-CY7)
CD19 antibody (PE-CY7) was raised in mouse using human CD19 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD11c antibody (FITC)
CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD154 antibody (Azide Free)
CD154 antibody (Azide free) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.
CD3e antibody (Allophycocyanin)
CD3e antibody (Allophycocyanin) was raised in rat using CD3e as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD38 antibody (Allophycocyanin)
CD38 antibody (Allophycocyanin) was raised in rat using CD38 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD21 antibody (FITC)
CD21 antibody (FITC) was raised in mouse using porcine CD21 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD16 antibody (FITC)
CD16 antibody (FITC) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)Purity:Min. 95%Molecular weight:0 g/molCD49b antibody (Allophycocyanin-CY7)
CD49b antibody (Allophycocyanin) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD16 antibody (PE)
CD16 antibody (PE) was raised in mouse using human polymorphonuclear leukocytes as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD44 antibody (FITC)
CD44 antibody (FITC) was raised in rat using murine CD44 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD49b antibody (FITC)
CD49b antibody (FITC) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD49d antibody (Azide Free)
CD49d antibody (Azide free) was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.CD3e antibody (Allophycocyanin)
CD3e antibody (Allophycocyanin) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD163 antibody (biotin)
CD163 antibody (biotin) was raised in mouse using human monocytes as the immunogen.CD3e antibody (Spectral Red)
CD3e antibody (Spectral Red) was raised in mouse using porcine CD3e as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD122 antibody (FITC)
CD122 antibody (biotin) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD11b antibody (Azide Free)
CD11b antibody (Azide Free) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.CD117 antibody (Spectral Red)
CD117 antibody (Allophycocyanin) was raised in rat using murine CD117/c-Kit as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD25 antibody (Allophycocyanin)
CD25 antibody (Allophycocyanin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD11b antibody (Spectral Red)
CD11b antibody (CY5) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD3 antibody (PE-CY7)
CD3 antibody (PE-CY5.5) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.CD22 antibody (biotin)
CD22 antibody (biotin) was raised in rat using CD22 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molDostarlimab
CAS:Dostarlimab binds with high affinity to human PD-1 and competitively inhibits its interaction with its ligands PD-L1 and PD-L2
