Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
anti-Dog CRP Antibody (Goat) - Affinity Purified
Affinity Purified Goat anti-Dog CRP AntibodyPurity:Min. 95%anti-Mouse IgA Antibody (Rabbit) - Affinity Purified
Affinity Purified Rabbit anti-Mouse IgA (alpha chain specific).Purity:Min. 95%anti-C-Myc Antibody (Chicken) - Affinity Purified
Please enquire for more information about anti-C-Myc Antibody (Chicken) - Affinity Purified including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%anti-Chicken IgY Fc Antibody (Goat) - Affinity Purified
Affinity Purified Goat anti-Chicken IgY Fc Antibody. Please inquire for bulk pricing or custom conjugations.
Purity:Min. 95%Mouse IgG2a Kappa - Isotype Control
Isotype controls are non-reactive immunoglobulins of the same isotype as the primary antibody being used in an application. It is recommended that a non-reactive immunoglobulin of the same isotype and concentration be included as a negative control for each monoclonal antibody reagent used in flow cytometry or other immunoassays.Purity:Min. 95%Rabbit anti- KLH - Affinity Purified
This Affinity Purified Rabbit anti-KLH Antibody reacts with Keyhole Limpet Hemocyanin in various immunoassays.Purity:Min. 95%anti-ASFV p72 Antibody - Affinity Purified
African Swine Fever (ASF) is a highly contagious viral disease that affects domestic and wild pigs. It is caused by the African Swine Fever virus (ASFV), which is a large, complex DNA virus. ASF does not pose a direct threat to human health, but it can have severe economic implications for the swine industry.Purity:Min. 95%anti-Mouse IgG+IgM+IgA (Fc) Antibody (Goat) - Affinity Purified
Affinity Purified Goat anti-Mouse IgG, IgM, IgA (Fc)Purity:Min. 95%Goat anti-Mouse IgG Antibody - Affinity Purified
This Affinity Purified Goat anti-Mouse IgG h+l antibody reacts with the heavy chain and light chains of mouse IgG and the light chains of other antibody classes. It can be used as a detection antibody in a variety of immunoassays.Purity:Min. 95%Affinity Purified Rabbit anti-Goat IgG Fc
Please enquire for more information about Affinity Purified Rabbit anti-Goat IgG Fc including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Affinity Purified Goat anti-Mouse IgG, IgM, IgA
Affinity Purified Goat anti-Mouse IgG, IgM, IgA
Purity:Min. 95%HRP Conjugated Rabbit anti-Bovine Beta Lactoglob4Gin
Affinity Purified Rabbit anti-Bovine Beta LactoglobulinPurity:Min. 95%anti-Hamster (CHO) Glutathione S-Transferase P Monoclonal
Purified Monoclonal Mouse anti-Glutathione S Transferase Pi (GSTp) AntibodyGlutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.
Purity:Min. 95%anti-Hamster IgG h+l (min. reactivity w/ Ms, Rt) - Affinity Purified
Affinity Purified Goat anti-Hamster IgG h+l Antibody (min. reactivity w/ Ms, Rt)Purity:Min. 95%F(ab)2 Goat anti-Hamster IgG h+l (min. reactivity w/ Ms, Rt) - Affinity Purified
anti-Hamster IgG h+l Antibody (min. reactivity w/ Ms, Rt)Purity:Min. 95%anti-Mouse IgG1 Antibody (Goat) - Affinity Purified
Affinity Purified Goat anti-Mouse IgG1 Antibody is validated for use in ELISA, Blotting, LFA and IHC applications.Purity:Min. 95%anti-Mouse IgM Antibody (Goat) - Affinity Purified minimal reactivity with Human IgM
Affinity Purified Goat anti-Mouse IgM Antibody is validated for use in ELISA, Blotting, LFA and IHC applications.Purity:Min. 95%anti-Rabbit IgG h+l Antibody (Goat) - FITC Conjugated
FITC Conjugated Goat anti-Rabbit IgG h+l. Please inquire for bulk pricing.Purity:Min. 95%anti-Canine Heartworm Antibody, Ads (Chicken) - Affinity Purified
Affinity Purified Chicken anti-Canine Heartworm Antibody, adsPurity:Min. 95%anti-ASFV p30 Antibody - Affinity Purified
African Swine Fever (ASF) is a highly contagious viral disease that affects domestic and wild pigs. It is caused by the African Swine Fever virus (ASFV), which is a large, complex DNA virus. ASF does not pose a direct threat to human health, but it can have severe economic implications for the swine industry.Purity:Min. 95%Affinity Purified Rabbit anti-Bovine Beta Lactoglob4Gin
Affinity Purified Rabbit anti-Bovine Beta LactoglobulinPurity:Min. 95%anti-Human Troponin I Antibody (Chicken)
Affinity Purified Chicken anti-Human Cardiac Troponin IPurity:Min. 95%anti-Human IgG Fc Antibody (Goat) - F(ab')2
This antibody can be used as a Human IgG detection or capture antibody in a variety of immunoassays.Purity:Min. 95%Mouse IgG2a κ - Isotype Control
Isotype controls are non-reactive immunoglobulins of the same isotype as the primary antibody being used in an application. It is recommended that a non-reactive immunoglobulin of the same isotype and concentration be included as a negative control for each monoclonal antibody reagent used in flow cytometry or other immunoassays.Purity:Min. 95%anti-Mouse IgM Antibody (Goat) - Affinity Purified
Affinity Purified Goat anti-Mouse IgM Antibody is validated for use in ELISA, Blotting, LFA and IHC applications.Purity:Min. 95%anti-GST Tag Antibody (Chicken) - Affinity Purified
Affinity Purified Chicken anti-GST AntibodyPurity:Min. 95%Rabbit anti-Chicken Ovalbumin-Affinity Purified
Rabbit anti-Chicken Ovalbumin-Affinity Purified
Purity:Min. 95%anti-beta Galactosidase Antibody (Rabbit) - IgG Fraction
Please enquire for more information about anti-beta Galactosidase Antibody (Rabbit) - IgG Fraction including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Goat anti-Mouse IgG2a Fc - Affinity Purified
This Affinity Purified Goat anti-Mouse IgG2a antibody only reacts with the heavy chain of the IgG2a subclass. It can be used as a capture or detection antibody in a variety of immunoassays.Purity:Min. 95%F(AB')2 Affinity Purified Goat anti-Mouse IgG Fc+IgM ads Human
Goat anti-Mouse IgG, IgM F(AB)2Purity:Min. 95%anti-Mouse IgG3 Antibody (Goat) - Affinity Purified
This Affinity Purified Goat anti-Mouse IgG3 antibody only reacts with the heavy chains of the IgG3 subclass. It can be used as a capture or detection antibody in a variety of immunoassays.Purity:Min. 95%anti-Mouse IgG2a Antibody (Goat) - Affinity Purified
Affinity Purified Goat anti-Mouse IgG2a antibody is validated for use in ELISA, Blotting, LFA and IHC assays.Purity:Min. 95%anti-Human Apolipoprotein C-III Antibody (Goat) - Affinity Purified
Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles.Purity:Min. 95%anti-Goat IgG h+l Antibody (Sheep) - Affinity Purified ads vs Bovine
Affinity Purified Sheep anti-Goat IgG h+l Antibody
Purity:Min. 95%anti-Human Haptoglobin Antibody (Rabbit) - Affinity Purified
anti-Human Haptoglobin AntibodyPurity:Min. 95%Pig IgG Purified
The purified Pig IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.Purity:Min. 95%anti-Mouse IgG1 Fc Antibody (Goat) - Affinity Purified
anti-Mouse IgG1 Fc Antibody (Goat) - Affinity Purified
Purity:Min. 95%anti-Human IgG Fc Antibody (Goat) - Affinity Purified
This antibody can be used as a Human IgG detection or capture antibody in a variety of immunoassays.Purity:Min. 95%anti-Human Apolipoprotein A-II Antibody (Goat) - Affinity Purified
This antibody reacts with Human Apolipoprotein A-II (ApoA2), which is the second most abundant protein of the high density lipoprotein particles. ApoA2 is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D.
Purity:Min. 95%anti-Human Haptoglobin Antibody (Goat) - Affinity Purified
anti-Human Haptoglobin AntibodyPurity:Min. 95%anti-FITC Antibody (Mouse - Clone #5B4) - Monoclonal
Please enquire for more information about anti-FITC Antibody (Mouse - Clone #5B4) - Monoclonal including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%anti-Mouse IgG2b Antibody (Goat) - Affinity Purified
This Affinity Purified Goat anti-Mouse IgG2b antibody only reacts with the heavy chains of the IgG2b subclass. It can be used as a capture or detection antibody in a variety of immunoassays.Purity:Min. 95%anti-Human IgG Fc Antibody (Goat) - HRP Conjugated
HRP Conjugated Goat anti-Human IgG Fc AntibodyPurity:Min. 95%F(ab')2 Affinity Purified Goat anti-Human IgG, IgM, IgA
Affinity Purified Goat anti-Mouse IgG, IgM, IgA minimal reactivity with Human
Purity:Min. 95%anti-Human Apolipoprotein E Antibody (Goat) - Affinity Purified
Apolipoprotein-E (ApoE) is a multifunctional protein with central roles in lipid metabolism, neurobiology, and neurodegenerative diseases.Purity:Min. 95%anti-Dog IgG h+l Antibody (Goat) - Affinity Purified
Affinity Purified Goat anti-Dog IgG h+l Antibody. Please inquire for bulk pricing and custom conjugations. Bulk antiserum also available.Purity:Min. 95%anti-Dengue NS1 Antibody (Goat) - Affinity Purified
Affinity Purified Goat anti-Dengue NS1 Antibody. Please inquire for bulk pricing.Purity:Min. 95%Chicken anti-Rabbit IgG h+l (min. reactivity w/ Hu, Ms) - Affinity Purified
Affinity Purified Chicken anti-Rabbit IgG h+l Antibody (Minimal reactivity w/ Human & Mouse)
Purity:Min. 95%HRP Conjugated Mouse anti-Bovine Beta Lactoglob4Gin (Clone #6B9)
Affinity Purified Rabbit anti-Bovine Beta Lactoglobulin
Purity:Min. 95%Affinity Purified Goat anti-Mouse IgG, IgM, IgAminimal reactivity with Human
Affinity Purified Goat anti-Mouse IgG, IgM, IgA minimal reactivity with HumanRabbit anti-Chicken Ovalbumin-Affinity Purified
Rabbit anti-Chicken Ovalbumin-Affinity PurifiedPurity:Min. 95%anti-Dog IgE Antibody (Goat) - HRP Conjugated
This HRP Conjugated Goat anti-Dog IgE specifically reacts with the IgE heavy chain and not with IgG, IgA, IgM or IgD. It is suitable for use as the detection antibody in various immunoassays.Purity:Min. 95%λ Free Light Chain, Highly Purified
Lambda Free Light Chain, Highly Purified is an antibody for use in IVD applications. Please enquire for more information about Lambda Free Light Chain, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.Purity:>96% By Sds-Page Under Reducing ConditionsHCV Core/NS3/NS4/NS5 Antigen, Recombinant
HCV Core/NS3/NS4/NS5 Antigen, Recombinant is an antibody for use in IVD applications. Please enquire for more information about HCV Core/NS3/NS4/NS5 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.Candida albicans antibody
Candida albicans antibody was raised in mouse using Candida albicans, mixed strains as the immunogen.HB antibody
HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIPAnti-γ-H2AX (pS139) antibody - 1mg/mL
Antibody which recognises the phosphorylated form of the H2A histone variant H2AX. H2AX is rapidly phosphorylated on serine 139 in response to DNA double strand breaks (DSBs). DSBs occur as part of the natural process of meiosis, and in response to external stimuli and mutagens. In either form, DSBs pose a huge threat to genome integrity and must be repaired quickly and accurately. In mammalian cells, repair of DSBs is carried out primarily by either homologous recombination (HR) or non-homologous end joining (NHEJ). Upon DNA damage, phosphorylated H2AX, termed 'γH2AX', quickly accumulates and initiates a DNA damage signalling cascade at the DSB site. γH2AX also alters the chromatin at the DSB site to form an area accessible to the protein interactions and modifications required for DSB repair. Anti-γH2AX can be seen to stain DSBs shortly after formation to form bright foci associated with the chromatin at the DSB site.OXTR antibody
OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Rabbit anti Mouse IgM
Rabbit anti-mouse IgM was raised in rabbit using murine IgM mu heavy chain as the immunogen.Purity:Min. 95%Goat anti Human IgG (H + L) (biotin)
Goat anti-human IgG (H+L) (biotin) was raised in goat using human IgG whole molecule as the immunogen.Purity:Min. 95%LANCL2 antibody
LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKPurity:Min. 95%Prednisolone antibody
The Prednisolone antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and specifically targets 13-acetate. This polyclonal antibody is designed to detect and bind to prednisolone, a synthetic glucocorticoid hormone commonly used in medical treatments.Purity:Min. 95%
