Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
LKB1 antibody
The LKB1 antibody is a monoclonal antibody that plays a crucial role in inhibiting the growth factor signaling pathway. It is water-soluble and specifically targets enteroendocrine cells, which are responsible for regulating glucose homeostasis and insulin secretion. This antibody has shown promising results in reducing amyloid plaque formation in Alzheimer's disease models, making it a potential therapeutic option for treating this neurodegenerative disorder. Additionally, the LKB1 antibody has cytotoxic effects on cancer cells by inhibiting endothelial cell growth and disrupting tumor angiogenesis. It can be used as a research tool in various life sciences studies, including investigating dopamine signaling pathways and assessing microvessel density. With its neutralizing properties, this mouse monoclonal antibody is highly valuable for both basic research and potential therapeutic applications.
RAD17 antibody
The RAD17 antibody is a highly specialized inhibitor used in Life Sciences research. It targets the RAD17 protein, which plays a crucial role in DNA repair and cell cycle regulation. This antibody is commonly used in assays to study the function of RAD17 and its interactions with other proteins involved in DNA damage response pathways. The RAD17 antibody is a polyclonal antibody, meaning it is produced by multiple clones of B cells and can recognize different epitopes on the target protein. Its high specificity makes it an ideal tool for studying the effects of RAD17 inhibition on various cellular processes. Researchers also use this antibody to investigate the potential therapeutic applications of targeting RAD17 in diseases such as cancer. With its exceptional binding affinity and selectivity, the RAD17 antibody offers valuable insights into the intricate mechanisms underlying DNA repair and genome stability.RP2 antibody
RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGFilaria Antibody
Filaria Antibody is a highly effective and specialized medication that targets specific antibodies, including anti-cd25 antibody drugs. It falls under the category of histone deacetylase inhibitors and is known for its potent amide and heteroaromatic properties. Developed for use in the field of Life Sciences, this monoclonal antibody has been extensively tested and proven to be highly activated against filaria infections.STAU1 antibody
STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG
TTF1 antibody
The TTF1 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It is designed to target and bind to the thyroid transcription factor 1 (TTF1), which plays a crucial role in regulating the expression of genes involved in cholinergic signaling and glycan synthesis. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.PYCR2 antibody
PYCR2 antibody was raised using the middle region of PYCR2 corresponding to a region with amino acids LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRECOL1A2 antibody
The COL1A2 antibody is a powerful tool used in Life Sciences research. It specifically targets collagen, a crucial component of connective tissues, and can be used to investigate various cellular processes. This antibody has been shown to neutralize the effects of dopamine, TGF-beta1, and interferon, making it an essential tool for studying their roles in different biological systems. Additionally, the COL1A2 antibody has been used to successfully detect and measure the levels of activated polymerase enzyme and TGF-beta growth factor in samples. It is available as a polyclonal antibody and has also been used in studies involving phosphatase and glutamate. With its high specificity and reliability, the COL1A2 antibody is an invaluable asset for researchers aiming to unravel the intricacies of collagen-related processes.GALM antibody
GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKOSBPL1A antibody
OSBPL1A antibody was raised using the middle region of OSBPL1A corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSIInvolucrin antibody
The Involucrin antibody is a highly specialized monoclonal antibody that targets the biomolecule involucrin. It is commonly used in Life Sciences research to study the role of involucrin in various biological processes. Involucrin is a glycoprotein that plays a crucial role in the formation and maintenance of the skin barrier. This antibody specifically binds to involucrin, allowing researchers to study its function and localization within cells.LYPD5 antibody
LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPp27 Kip1 antibody
The p27 Kip1 antibody is a highly specialized antibody that is used in various research applications in the field of Life Sciences. It is an autoantibody that specifically targets the p27 Kip1 protein, which plays a crucial role in regulating cell cycle progression and cell proliferation. This antibody is colloidal in nature, allowing for easy and efficient detection of the p27 Kip1 protein in biological samples.RORA antibody
RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCCARD17 antibody
CARD17 antibody was raised in rabbit using the middle region of CARD17 as the immunogenRNF128 antibody
RNF128 antibody was raised using the C terminal of RNF128 corresponding to a region with amino acids LEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREITBX18 antibody
The TBX18 antibody is a highly specialized monoclonal antibody that has been developed for specific chemical detection. It is designed to bind to the TBX18 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has a high affinity for TBX18 and can be used in various applications such as enzyme complex assays, solid-phase DNA binding, and microtiter plate-based experiments. The TBX18 antibody has been optimized for use in hydrogen atom studies and has a pH optimum range that ensures accurate and reliable results. Additionally, it has been tested extensively on HL-60 cells and collagen samples to ensure its effectiveness and specificity. Whether you are conducting research or diagnostic testing, the TBX18 antibody is an invaluable tool that will provide you with accurate and reliable results.
PGAM2 antibody
PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM
STAT5A antibody
The STAT5A antibody is a highly specialized antibody that targets the STAT5A protein, which plays a crucial role in various cellular processes. This antibody specifically recognizes and binds to the growth factor receptor, epidermal growth factor receptor (EGFR), as well as human chorionic gonadotropin (hCG) receptors. It has been extensively used in the field of Life Sciences for research purposes.CD80 antibody (Azide Free)
CD80 antibody (Azide free) was raised in rat using CD80/B7-1 as the immunogen.CD86 Antibody
The CD86 Antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets the CD86 molecule, which is involved in immune responses and cell signaling. It has been extensively researched and shown to be effective in various applications.EXOSC2 antibody
EXOSC2 antibody was raised using the middle region of EXOSC2 corresponding to a region with amino acids AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGDDX3X antibody
DDX3X antibody was raised using a synthetic peptide corresponding to a region with amino acids MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKDAZL antibody
DAZL antibody was raised using the C terminal of DAZL corresponding to a region with amino acids EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRSLC6A18 antibody
SLC6A18 antibody was raised using the middle region of SLC6A18 corresponding to a region with amino acids MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
STAT3 antibody
The STAT3 antibody is a polyclonal antibody that specifically targets the STAT3 protein. STAT3 is a transcription factor that plays a crucial role in various cellular processes, including cell growth, differentiation, and survival. This antibody binds to the STAT3 protein and inhibits its activity, thereby preventing the downstream effects of STAT3 signaling.DHX15 antibody
DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLSTRBP antibody
STRBP antibody was raised using the middle region of STRBP corresponding to a region with amino acids PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNSADAD2 antibody
ADAD2 antibody was raised using the middle region of ADAD2 corresponding to a region with amino acids GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPPGoat anti Monkey IgM (Alk Phos)
Goat anti-monkey IgM (Alk Phos) was raised in goat using monkey IgM as the immunogen.DYSFIP1 antibody
DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKNeuroD antibody
The NeuroD antibody is a highly specialized monoclonal antibody that has been developed for research purposes in the field of Life Sciences. It is specifically designed to target and detect the presence of NeuroD, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity, making it an ideal tool for studying the function and expression of NeuroD in different biological systems.cTnT antibody
The cTnT antibody is a highly specialized collagen monoclonal antibody that targets phosphorylcholine, which is activated by inorganic particles. This medicament is particularly effective in the field of Life Sciences and has been widely used in research involving mesenchymal stem cells. The cTnT antibody is known for its exceptional ability to detect and bind to specific contaminants, making it an invaluable tool for quality control purposes. Additionally, this antibody exhibits cytotoxic properties against unwanted growth factors and glycoproteins, further enhancing its utility in various applications. With both Polyclonal Antibodies and monoclonal antibodies available, researchers have the flexibility to choose the most suitable option for their specific needs.PRR16 antibody
PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPLPCMTD1 antibody
PCMTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIYp53 antibody
The p53 antibody is a growth factor that belongs to the family of GM-CSF (granulocyte-macrophage colony-stimulating factor) antibodies. It can be used for various applications in life sciences research. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their experiments. The p53 antibody has been extensively studied and validated for its ability to neutralize the activity of p53 dimers, which play a crucial role in cell cycle regulation and tumor suppression. Additionally, this antibody can be used for immobilization on electrodes or as a tool for phosphatase assays. With its high specificity and cytotoxicity, the p53 antibody is an essential component in many research projects within the field of life sciences.
CACNB1 antibody
CACNB1 antibody was raised using the N terminal of CACNB1 corresponding to a region with amino acids EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS
C6orf154 antibody
C6orf154 antibody was raised using the N terminal of C6orf154 corresponding to a region with amino acids MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRFBXO33 antibody
FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
EDG6 antibody
The EDG6 antibody is a highly specialized inhibitor that targets serine protease activity. It has been extensively tested and proven to effectively neutralize the function of this enzyme. This polyclonal antibody is derived from human serum and can be used in various applications, including nuclear extracts and spectrometric analysis.
CD318 antibody
The CD318 antibody is a monoclonal antibody that is used in Life Sciences research. It is specifically designed to target and bind to the CD318 antigen, which is found on the surface of activated cells. This antibody can be used in various applications, such as flow cytometry, immunohistochemistry, and Western blotting.
