Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
BAX antibody
The BAX antibody is a highly specialized monoclonal antibody that targets the BAX protein, which plays a crucial role in programmed cell death (apoptosis). This steroid and multidrug-resistant protein is involved in regulating the release of cytochrome c from mitochondria, ultimately leading to apoptosis. The BAX antibody specifically binds to the BAX protein, preventing its function and promoting cell survival.SATB1 antibody
The SATB1 antibody is a highly specialized monoclonal antibody that has been developed for targeted therapy in various medical applications. This antibody specifically targets and binds to SATB1, a protein that plays a crucial role in gene regulation and cellular function. By binding to SATB1, this antibody can modulate its activity and inhibit the growth of certain cells.TDGF1 antibody
The TDGF1 antibody is a monoclonal antibody that targets E-cadherin, a basic protein involved in cell adhesion. It acts as a neutralizing agent against epidermal growth factor (EGF), a potent growth factor that plays a crucial role in cell proliferation and differentiation. The TDGF1 antibody is widely used in the field of life sciences for various applications, including immunohistochemistry and Western blotting.ALAS2 antibody
ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNBFSP1 antibody
BFSP1 antibody was raised using the N terminal of BFSP1 corresponding to a region with amino acids QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEMSRF antibody
The SRF antibody is a polyclonal antibody that targets the Serum Response Factor (SRF). SRF is a transcription factor that plays a crucial role in regulating gene expression, particularly in response to various stimuli such as interleukin-6, cholinergic signaling, and interferon. This antibody is widely used in life sciences research to study the function and regulation of SRF.MVK antibody
MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAAPPP1CA antibody
PPP1CA antibody was raised using the N terminal of PPP1CA corresponding to a region with amino acids MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCPIM1 antibody
PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
PCNA antibody
The PCNA antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets proliferating cell nuclear antigen (PCNA), which plays a crucial role in DNA replication and repair. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry.
Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.GABARAP antibody
GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV
RHOF antibody
RHOF antibody was raised using a synthetic peptide corresponding to a region with amino acids DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMCD20 antibody
The CD20 antibody is a monoclonal antibody that specifically targets the CD20 protein found on the surface of B cells. It is used in the treatment of various autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis. The CD20 antibody works by binding to the CD20 protein, which triggers an immune response that leads to the destruction of B cells. This can help reduce inflammation and alleviate symptoms associated with these conditions. Additionally, the CD20 antibody has shown promising results in clinical trials for the treatment of certain types of cancer, including lymphoma.cRAF antibody
The cRAF antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets cRAF, a protein involved in the mitogen-activated protein kinase (MAPK) pathway. This pathway plays a crucial role in cell proliferation, differentiation, and survival. The cRAF antibody has been extensively studied and shown to have neutralizing effects on various factors such as TNF-α, hepcidin, and parathyroid hormone-related peptide.ITGA7 antibody
The ITGA7 antibody is a highly specialized monoclonal antibody designed to target and inhibit the activity of the protein kinase CDK4/6. It is commonly used in antiestrogen therapy and has been shown to effectively block the growth factor signaling pathway. This antibody specifically binds to the bromodomain of the target protein, preventing its interaction with fatty acids and disrupting downstream signaling cascades. In addition, the ITGA7 antibody has natriuretic properties, further contributing to its therapeutic potential. This high-quality antibody is widely used in Life Sciences research and is available in both polyclonal and monoclonal forms. With its exceptional specificity and potency, the ITGA7 antibody is a valuable tool for studying protein-protein interactions and developing novel therapeutic strategies.PPIB antibody
PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKEHMG2L1 antibody
HMG2L1 antibody was raised in mouse using recombinant Human High-Mobility Group Protein 2-Like 1Mouse anti Human Kappa Light Chain antibody
Mouse monoclonal Mouse anti Human Kappa Light Chain antibody
SLO antibody
The SLO antibody is a highly specialized monoclonal antibody that is used in various research applications. It is specifically designed to target and bind to the SLO protein, which plays a crucial role in cell growth and development. This antibody has been extensively tested and validated for its specificity and sensitivity, making it an ideal tool for studying the function of SLO in different biological systems.Vimentin antibody
The Vimentin antibody is a highly specialized monoclonal antibody that is designed to target and bind to vimentin, a protein that plays a crucial role in cell structure and movement. This antibody is derived from chimeric proteins and has been biotinylated for easy detection and visualization. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.CD89 antibody
The CD89 antibody is a highly specialized polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and bind to the glial fibrillary acidic protein kinase, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying the levels of glial fibrillary acidic protein kinase in various biological samples.BIN3 antibody
The BIN3 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to a growth factor, which plays a crucial role in various biological processes. The binding of the BIN3 antibody to the growth factor disrupts its function and prevents it from interacting with its receptors.PDZK1 antibody
The PDZK1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets PDZK1, a protein involved in various cellular processes. This antibody has been shown to neutralize the activity of PDZK1 and inhibit its function as a phosphatase. Additionally, it has cytotoxic effects on cells expressing high levels of PDZK1. The PDZK1 antibody can be used in experiments involving cell signaling pathways, growth factors, and colony-stimulating factors. It is also useful for studying the interaction between PDZK1 and other proteins such as annexin and calmodulin. This high-quality antibody is produced using advanced techniques and has been extensively tested for specificity and efficacy.Lamin A antibody
The Lamin A antibody is a cytotoxic monoclonal antibody that targets elastase, autoantibodies, lectins, insulin, fibronectin, and collagen. It is commonly used in Life Sciences research to detect and study the expression of Lamin A protein. This antibody specifically binds to Lamin A and can be used in various applications such as immunofluorescence, immunohistochemistry, and Western blotting. Additionally, it has been shown to have anti-VEGF (vascular endothelial growth factor) activity and can be used in the development of therapeutic treatments for angiogenesis-related diseases. The Lamin A antibody is an essential tool for researchers studying cellular processes and protein interactions involved in various biological pathways.Thioredoxin 2 antibody
Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQRHOC antibody
The RHOC antibody is a highly specialized product used in the field of Life Sciences. This antibody specifically targets the basic protein RHOC, which plays a crucial role in various cellular processes. The RHOC antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.ALDOC antibody
The ALDOC antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets the ALDOC protein, which is involved in various cellular processes such as chemokine production, acetylation, and natriuretic regulation. This antibody can be used to study the expression and localization of ALDOC in different tissues and cell types.TPD52 antibody
TPD52 antibody was raised using the middle region of TPD52 corresponding to a region with amino acids AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGCasein Kinase 1 alpha antibody
Casein Kinase 1 alpha antibody was raised in mouse using recombinant human Casein Kinase 1 alpha (1-337aa) purified from E. coli as the immunogen.S6 antibody
The S6 antibody is a powerful tool used in various research applications. It is a cholinergic growth factor that has been extensively studied in the context of breast cancer, particularly in the MCF-7 cell line. This antibody targets acetyltransferase, an enzyme involved in the synthesis of acetylcholine, a neurotransmitter implicated in cell growth and proliferation.MUC1 antibody
The MUC1 antibody is an acidic glycopeptide that belongs to the family of Monoclonal Antibodies. It has been widely used in Life Sciences research for its cyclase-activating and neutralizing properties. This antibody specifically targets the MUC1 antigen, which is expressed at low densities on various cell types. The MUC1 antibody is highly specific and has been extensively characterized for its binding affinity and effectiveness in different experimental settings. It is commonly used as a primary antibody in immunoassays and can be conjugated with different labels for detection purposes. The MUC1 antibody is formulated with high-quality excipients to ensure stability and long shelf life. It does not contain any transferrin or other interfering substances that could affect the assay results. This antibody is suitable for a wide range of applications, including immunohistochemistry, flow cytometry, and Western blotting. Its excellent glycosylation profile ensures optimal performance and reliable results. Additionally, the MUC1 antibodySTAT5A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, inhibiting transcription and replication processes in bacteria. Extensive research has shown its high efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Remarkably, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside exhibits high affinity towards Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.EpCAM antibody
The EpCAM antibody is a retinoid that exhibits cytotoxic properties. It belongs to the class of Monoclonal Antibodies and has been shown to inhibit the production of tumor necrosis factor-α (TNF-α). This antibody specifically targets EpCAM, a protein that is highly expressed in cancer cells, particularly in breast cancer (MCF-7). By binding to EpCAM, the antibody inhibits cell growth and induces apoptosis. Additionally, this antibody has been found to modulate hepatocyte growth factor/fibroblast growth factor signaling pathways, which are involved in cell proliferation and migration. The EpCAM antibody can also interact with other extracellular matrix components such as creatine, collagen, and fibronectin. Its multidrug resistance inhibitors have shown promising results in preclinical studies, making it a potential therapeutic option in the field of Life Sciences. With its high specificity and low viscosity, the EpCAM antibody offers great potential for targeted therapy against various types of cancer.CDKN2AIP antibody
CDKN2AIP antibody was raised using the N terminal of CDKN2AIP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWANTrx antibody
The Trx antibody is a highly specific monoclonal antibody that targets a particular molecule. It is known for its neutralizing properties and its ability to bind to the target molecule with high affinity. The Trx antibody is commonly used in Life Sciences research, particularly in the field of Monoclonal Antibodies.RFXAP antibody
RFXAP antibody was raised in mouse using recombinant Regulatory Factor X-Associated Protein (Rfxap)
IRS1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.Actin antibody
The Actin antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets actin filaments, which are essential for cell structure and movement. It can be used in a variety of applications, including immunofluorescence, immunohistochemistry, and Western blotting.Fumarase antibody
Fumarase antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets fumarase, an enzyme involved in the Krebs cycle, and plays a crucial role in cellular energy production. This antibody has been extensively used to study various biological processes, including collagen synthesis, alpha-fetoprotein expression, and urokinase plasminogen activator activity. Additionally, it has proven valuable in investigating the role of fumarase in cell signaling pathways and growth factor regulation. The fumarase antibody is widely recognized for its high affinity and specificity, making it an essential tool for researchers working in diverse fields such as cell biology, immunology, and cancer research. With its ability to detect fumarase at a molecular level, this monoclonal antibody opens up new avenues for understanding complex biological mechanisms and developing novel therapeutic strategies.KRT8 antibody
The KRT8 antibody is a monoclonal antibody used in life sciences research. It specifically targets and binds to keratin 8 (KRT8), a protein found in epithelial cells. This antibody has been widely used in various bioassays and studies to detect the presence of KRT8 in different tissues and cell types. Additionally, it has shown potential therapeutic applications, such as in the development of targeted therapies for certain types of cancer.
ATP6AP1 antibody
The ATP6AP1 antibody is a highly specialized antibody that targets the ATP6AP1 protein. This protein is involved in various biological processes, including dopamine synthesis and secretion. The ATP6AP1 antibody has been extensively studied and found to be an effective tool for research purposes.
SRPRB antibody
SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKICD44 antibody
The CD44 antibody is a specific monoclonal antibody that targets the cell-extracellular matrix interaction. It is widely used in Life Sciences research for its ability to detect and analyze activated or reactive cells. This antibody can be used in various applications, including flow cytometry, immunohistochemistry, and Western blotting. The CD44 antibody recognizes a surface glycoprotein called CD44, which plays a crucial role in cell adhesion, migration, and signaling. By binding to CD44, this antibody can help researchers study the function of this important biomolecule and its involvement in various cellular processes. Additionally, the CD44 antibody has been shown to have cytotoxic effects on certain types of cancer cells, making it a promising tool for targeted therapy.
ERAL1 antibody
ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSELF2 antibody
ELF2 antibody was raised in mouse using recombinant Human E74-Like Factor 2 (Ets Domain Transcription Factor) (Elf2)FBXW8 antibody
FBXW8 antibody was raised using the middle region of FBXW8 corresponding to a region with amino acids MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRSOX13 antibody
The SOX13 antibody is a vasoactive intestinal peptide (VIP) neutralizing monoclonal antibody. It is a low-molecular-weight antibody that has been shown to effectively neutralize VIP in human serum. This monoclonal antibody can also target autoantibodies and has neuroprotective properties. Studies have demonstrated that the SOX13 antibody can protect against neurodegenerative diseases and reduce inflammation. Additionally, it has been found to enhance the effects of ketamine and interferon therapy. The electrode immobilization technique can be used to deliver the SOX13 antibody directly to target cells for optimal therapeutic results. If you are looking for high-quality antibodies for life sciences research, the SOX13 antibody is an excellent choice.H2AFY2 antibody
H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids PRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTBTN1A1 antibody
The BTN1A1 antibody is a highly effective neutralizing agent that targets the c-myc antigen. This monoclonal antibody is widely used in Life Sciences research and has been proven to have significant therapeutic potential. It specifically binds to BTN1A1, a protein involved in the regulation of low-density lipoprotein (LDL) metabolism. By targeting this protein, the BTN1A1 antibody can effectively modulate LDL levels and potentially serve as a medicament for various cardiovascular disorders.EGFR antibody
The EGFR antibody is a highly specialized antibody that targets the epidermal growth factor receptor (EGFR). It has been extensively studied and proven to be effective in various research fields. This antibody specifically binds to the nuclear region of cells and can be used for immunohistochemistry and immunofluorescence experiments. The EGFR antibody has been tested and validated for its specificity, ensuring accurate and reliable results.
