Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RG9MTD3 antibody
RG9MTD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRNSNAP25 antibody
The SNAP25 antibody is a highly effective tool in the field of Life Sciences. As a monoclonal antibody, it has the ability to specifically target and neutralize SNAP25, a protein involved in neurotransmitter release. This antibody can be used in various research applications, such as immunoassays, immunohistochemistry, and Western blotting.
Involucrin antibody
The Involucrin antibody is an activated monoclonal antibody that targets the protein involucrin. Involucrin is a marker of terminal differentiation in keratinocytes and is involved in the formation of the cornified envelope, which provides structural integrity to the skin. This antibody specifically binds to involucrin and can be used for various applications in life sciences research.
ZP4 antibody
The ZP4 antibody is a highly specialized antibody that targets low density proteins. It is available as both polyclonal and monoclonal antibodies, making it suitable for various research applications. This antibody has been extensively studied in relation to its role in autoimmune disorders and cancer.
GIT1 antibody
The GIT1 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the endonuclease GIT1, which plays a crucial role in various cellular processes. This antibody has been shown to interact with TGF-beta, collagen, and sugar moieties, indicating its involvement in extracellular matrix remodeling. Additionally, it has been found to possess EGF-like domains that may contribute to its binding affinity and specificity. The GIT1 antibody also exhibits hyaluronidase activity, suggesting its potential role in modulating the extracellular matrix composition. Studies have demonstrated its presence in human serum and its ability to regulate epidermal growth factor signaling pathways. Furthermore, this antibody has been investigated for its potential use as a therapeutic agent due to its ability to target glycoproteins and enhance hyaluronidase activity. Its pegylated form has shown promising results in inhibiting angiogenesis by reducing microvessel density.GALE antibody
GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRFRK antibody
The FRK antibody is a monoclonal antibody that targets chemokines and plays a crucial role in oxidative damage. This antibody is widely used in the field of Life Sciences for research purposes. It has been shown to inhibit the activity of epidermal growth factor and anti-HER2 antibodies, which are involved in endothelial growth and collagen synthesis. Additionally, the FRK antibody has been found to activate actin filaments and regulate the expression of E-cadherin. Its ability to detect autoantibodies makes it a valuable tool for studying various diseases and immune responses.Catenin antibody
Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNALDOA antibody
The ALDOA antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and neutralize the activity of serine protease ALDOA, which plays a crucial role in various biological processes. This antibody is capable of binding to ALDOA dimers and inhibiting their function.SPAG16 antibody
The SPAG16 antibody is a highly valuable protein in the field of Life Sciences. It is a polypeptide reagent that is widely used as a detection reagent for various biomarkers. Polyclonal Antibodies generated against SPAG16 have proven to be effective in inhibiting the activity of this protein, making them an essential tool in research and diagnostics. These antibodies can be used to detect and quantify SPAG16 levels in biological samples, making them valuable biomarker detection reagents. Additionally, they have been utilized to identify autoantibodies targeting SPAG16, which can provide important insights into autoimmune diseases and serve as potential therapeutic targets. The SPAG16 antibody plays a crucial role in advancing our understanding of cellular processes and has the potential to contribute significantly to the development of new medicines and treatments.NK1R antibody
The NK1R antibody is a highly effective medicament that belongs to the group of polyclonal antibodies. It is widely used in the field of Life Sciences for its exceptional properties. This antibody specifically targets and binds to the Neurokinin 1 receptor (NK1R), which plays a crucial role in various physiological processes. The binding of the NK1R antibody to its target leads to a cascade of events, including the inhibition of lectins and calmodulin, as well as the activation of growth factors and collagen synthesis.EGFR antibody
The EGFR antibody is a protein-based product that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR), an important growth factor involved in various cellular processes. This antibody has been extensively used in research and diagnostic applications.RXRA antibody
RXRA antibody was raised using the C terminal of RXRA corresponding to a region with amino acids MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQBIN2 antibody
The BIN2 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the fatty acid-binding protein known as BIN2. This protein plays a crucial role in various biological processes, including epidermal growth and the regulation of alpha-fetoprotein.RFP antibody
The RFP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the RFP protein, also known as red fluorescent protein. This antibody can be used for various applications, including immunofluorescence staining, Western blotting, and flow cytometry.U1A antibody
The U1A antibody is a highly specialized polyclonal antibody that is used in various immunoassays. It is specifically designed to neutralize the activity of the human protein U1A, which plays a crucial role in RNA splicing. This antibody can be used in research and diagnostic applications to study the function and regulation of U1A.
FECH antibody
FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFLCD90 antibody
CD90 antibody was raised in rat using murine T-Cell hybridoma c6/G8, produced by fusion of porl insulin-specific BALB/c T cells with the AKR thymoma line BW 5147 as the immunogen.STAT3 antibody
The STAT3 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the STAT3 protein, which plays a crucial role in various cellular processes. This antibody is made from cellulose and DNA aptamers, which are small molecules that can bind to specific proteins.ZW10 antibody
ZW10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAIEIpaD antibody
The IpaD antibody is a basic protein that belongs to the family of nuclear antibodies. It is a growth factor that has egf-like properties, making it effective in inhibiting amyloid plaque formation. This antibody also plays a role in glycosylation and can bind to serum albumin protein. The IpaD antibody is a monoclonal antibody, which means it is highly specific and targets a specific antigen. It has phosphatase activity and can be found in human serum. This antibody may also have potential as an autoantibody for certain conditions.NFkB p65 antibody
The NFkB p65 antibody is a highly specialized product in the field of Life Sciences. It is designed to detect and bind to the activated form of NFkB p65, a transcription factor involved in various cellular processes. This antibody is widely used in research and bioassays to study genotoxicity, inflammatory responses, and other related pathways.Beta catenin antibody
The Beta catenin antibody is a highly specialized antibody used in Life Sciences research. It is a polyclonal antibody that specifically binds to β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has been extensively studied for its role in various cellular processes, including development, tissue homeostasis, and cancer progression.THOC1 antibody
THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESDesmin antibody
Desmin antibody is a synthetic polyclonal antibody that specifically targets and neutralizes tyrosine-activated Desmin. It is widely used in Life Sciences research for immunohistochemistry and other applications. Desmin antibody has been shown to effectively inhibit the activity of Desmin, a protein involved in various cellular processes. This antibody can be used as a valuable tool for studying the role of Desmin in different biological systems and for developing potential therapeutic strategies targeting Desmin-related diseases. With its high specificity and reliability, Desmin antibody provides researchers with accurate and reproducible results in their experiments.Lamin antibody
Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKEA6 cells) as the immunogen.SLC39A8 antibody
The SLC39A8 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets the SLC39A8 protein, which plays a crucial role in the transport of essential metals across cell membranes. This antibody can be used to study the function of SLC39A8 in various biological processes, including intercellular communication, metal homeostasis, and immune response.CHTF18 antibody
CHTF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRCD14 antibody
CD14 antibody is a potent inhibitor that targets the CD14 protein, which plays a crucial role in immune response. It can be used as a substrate for small interfering RNA (siRNA) experiments to study gene expression and function. CD14 antibody specifically binds to phosphorylcholine, an antigen found on various bacterial pathogens, and can be used in conjunction with other antibodies such as anti-CD33 antibody to identify specific cell populations. Additionally, CD14 antibody has been shown to inhibit the binding of autoantibodies to their target antigens, making it a valuable tool in autoimmune disease research. This antibody also has growth factor-like properties and has been used in Life Sciences research for its ability to promote cell proliferation and survival. CD14 antibody is available in colloidal form or as monoclonal antibodies conjugated to microspheres for easy detection and isolation of target cells. Its use in studies involving chemokines and tumor necrosis factor-alpha (TNF-α) further highlights its versatilitySSX1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the rifamycins class. It is specifically designed to combat tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.Histone H3.1 antibody
Histone H3.1 antibody is a polyclonal antibody that specifically targets the histone protein H3.1. This antibody has been shown to have inhibitory effects on various proteins, including EGF-like inhibitors, chemokines, and epidermal growth factors. It also possesses neutralizing properties against TGF-beta and anti-ACTH antibodies. Additionally, this antibody has been found to interact with collagen and trastuzumab, a monoclonal antibody used in the treatment of certain types of cancer. The histone H3.1 antibody can be utilized in research studies to investigate the role of histones in gene regulation, cellular growth, and cytotoxicity.PGRMC1 antibody
The PGRMC1 antibody is a highly specialized antibody that targets the epidermal growth factor receptor. It has been shown to have neutralizing effects on the growth and proliferation of cancer cells, particularly in breast cancer cell lines such as MCF-7. This monoclonal antibody is widely used in life sciences research and has been proven effective in studies involving human hepatocytes and various carcinoma cell lines. Additionally, it has been used in polymerase chain reaction (PCR) experiments to detect the presence of PGRMC1 mRNA. The PGRMC1 antibody also plays a crucial role in cardiac muscle troponin regulation and has been found to interact with fatty acids and drugs like pioglitazone. With its high specificity and efficacy, this polyclonal antibody is an essential tool for researchers in the field of molecular biology and biomedical science.DLC8 antibody
The DLC8 antibody is a specialized Polyclonal Antibody commonly used in Life Sciences research. It targets the circumsporozoite protein, a nuclear protein involved in various cellular processes. This antibody has been extensively tested and found to have high specificity and affinity for its target.RPL10A antibody
RPL10A antibody was raised using the N terminal of RPL10A corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSHA Tag antibody
The HA Tag antibody is a highly efficient and potent inhibitor used in drug preparation. This monoclonal antibody specifically targets the human serum protein known as HA (hemagglutinin). It is widely used in various applications, including cytometry analysis, electrochemical impedance spectroscopy, and life sciences research.MDC antibody
MDC antibody was raised in mouse using highly pure recombinant human MDC as the immunogen.TIPARP antibody
TIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSLRAB5B antibody
The RAB5B antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets RAB5B, a protein involved in various cellular processes. This antibody can be used for applications such as immunohistochemistry, western blotting, and immunoprecipitation.RAD52 antibody
The RAD52 antibody is a highly specific monoclonal antibody that targets the RAD52 protein. It has been extensively tested and validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is derived from human serum and has been shown to exhibit high affinity and specificity towards RAD52.PAPPA antibody
The PAPPA antibody is a highly specialized DNA aptamer that specifically targets collagen and alpha-fetoprotein. This monoclonal antibody has been extensively used in the field of life sciences for ultrasensitive detection of these biomarkers. The PAPPA antibody is known for its high affinity and specificity, making it an excellent tool for research and diagnostic purposes. It can be utilized in various applications, including immunoassays, immunohistochemistry, and western blotting. With its ability to bind to specific targets with exceptional precision, the PAPPA antibody offers researchers a reliable and efficient means of studying the role of collagen and alpha-fetoprotein in various biological processes. Whether you are studying protein interactions or developing a DNA vaccine, this monoclonal antibody will undoubtedly enhance your research capabilities.
Integrin beta 3 antibody
Integrin beta 3 antibody is a polyclonal antibody that specifically targets annexin A2, a basic protein involved in various cellular processes. This antibody can be used in life sciences research to study the role of annexin A2 in different pathways and functions. It has been shown to interact with natriuretic peptides, fatty acids, growth factors, and other proteins. Additionally, integrin beta 3 antibody has applications in the field of immunology, where it can be used to detect and quantify annexin A2 levels in biological samples. Whether you're studying erythropoietin or interleukin-6 signaling or investigating cellular interactions involving annexins, this monoclonal antibody is a valuable tool for your research.p38 MAPK antibody
The p38 MAPK antibody is a highly specialized antibody that targets the p38 mitogen-activated protein kinase (MAPK) pathway. This pathway plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The p38 MAPK antibody specifically binds to the p38 MAPK protein, blocking its activity and preventing downstream signaling.CLIC2 antibody
CLIC2 antibody was raised using the middle region of CLIC2 corresponding to a region with amino acids HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLC14ORF104 antibody
C14ORF104 antibody was raised using the N terminal Of C14Orf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG
