Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
EMA antibody
The EMA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to fibrinogen, a glycoprotein involved in blood clotting. This antibody is produced using hybridoma cell lines, which are created by fusing immune cells with tumor cells. The resulting hybridoma cells have the ability to produce large quantities of the EMA antibody.APPL1 antibody
The APPL1 antibody is a highly specific and potent antibody that can be used for various applications in research and diagnostics. It is available as both polyclonal and monoclonal antibodies, providing flexibility for different experimental needs.GRK2 antibody
The GRK2 antibody is a highly specialized protein that plays a crucial role in regulating the growth factor signaling pathway. It specifically targets trastuzumab, an EGF-like growth factor, and inhibits its activity by binding to it. This monoclonal antibody acts as a proton pump inhibitor, preventing the release of protons from collagen and thereby reducing collagen-induced cytotoxicity. Additionally, the GRK2 antibody has been shown to inhibit chemokine signaling and enhance the efficacy of other antibodies such as sorafenib and doxorubicin. In the field of life sciences, this antibody is widely used in research and development for studying TGF-beta signaling pathways. With its unique characteristics and versatile applications, the GRK2 antibody is an essential tool for scientists and researchers in various disciplines.PRTFDC1 antibody
PRTFDC1 antibody was raised using the N terminal of PRTFDC1 corresponding to a region with amino acids AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD
TAU antibody
The TAU antibody is a highly specialized Polyclonal Antibody that targets and interacts with the tau protein, a key component of the neurofibrillary tangles found in Alzheimer's disease and other tauopathies. This antibody is specifically designed to recognize and bind to tau proteins in various biological samples, including brain tissue sections, cell lysates, and cerebrospinal fluid.APC antibody
APC protein antibody was raised in Rat using GST fusion protein having the APC region B as the immunogen.SERPINB2 antibody
The SERPINB2 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to SERPINB2, an acidic protein found in human serum. This antibody has been shown to be highly effective in detecting and quantifying the levels of SERPINB2 in various biological samples.EPHB3 antibody
The EPHB3 antibody is a highly specialized cytotoxic agent that targets the EPHB3 receptor. This receptor plays a crucial role in cell signaling pathways, including phosphatase and TNF-related apoptosis-inducing ligand (TRAIL) pathways. By binding to the EPHB3 receptor, this antibody inhibits its activity, leading to decreased cell growth and survival.FH antibody
FH antibody is a monoclonal antibody that specifically targets nuclear β-catenin, which is involved in various cellular processes. This antibody can be used in bioassays to study the role of β-catenin in different biological systems. FH antibody has been shown to have inhibitory effects on steroid production and can be used as a tool for studying steroidogenesis. In addition, this antibody has potential applications in the field of life sciences for the development of therapeutic antibodies or inhibitors targeting specific proteins or pathways. FH antibody also shows binding affinity to collagen and plasticizers, making it useful for applications involving these materials. Furthermore, FH antibody has been studied for its potential use in treating choroidal neovascularization and androgen-related disorders.UQCRC2 antibody
The UQCRC2 antibody is a potent antifibrotic agent that works by targeting and lysing specific cells involved in fibrosis. This monoclonal antibody has been extensively studied and validated using polymerase chain techniques, demonstrating its high specificity and efficacy. It has also been shown to effectively neutralize autoantibodies and inhibit the activation of mesenchymal stem cells, which play a crucial role in fibrotic processes. The UQCRC2 antibody specifically targets atypical hemolytic cells by binding to their surface receptors, leading to their destruction. Additionally, this antibody can be used for immunohistochemical detection of protein complexes, such as serine proteases or amyloid plaques, making it a valuable tool for research and diagnostic purposes. Available as both polyclonal and monoclonal antibodies, the UQCRC2 antibody offers a versatile solution for various applications in the field of immunology.CDH1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.LSM4 antibody
LSM4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKFABP antibody
The FABP antibody is a monoclonal antibody that specifically targets fatty acid binding proteins (FABPs). FABPs are involved in the transportation and metabolism of fatty acids within cells. This antibody can be used for various applications, including research studies on the role of FABPs in cellular processes, as well as diagnostic tests for certain diseases.D-dimer antibody
D-dimer antibody is a monoclonal antibody used in the field of Life Sciences for various applications. It has been extensively studied and proven to be effective in detecting D-dimer, a fibrin degradation product that is elevated in blood plasma during thrombotic events. This antibody can be used in electrochemical biosensing techniques, such as electrochemical impedance spectroscopy and chemiluminescence immunoassay, to accurately measure D-dimer levels. The D-dimer antibody is immobilized on a carbon electrode or colloidal gold surface, allowing for specific binding with D-dimer molecules present in the sample. Its high selectivity and sensitivity make it an ideal tool for diagnosing and monitoring thrombotic disorders. Additionally, this antibody has shown promising antioxidant activity, making it a potential candidate for further research in the field of lipid composition and estradiol level regulation.PD1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique, which have demonstrated its high efficacy in inhibiting bacterial growth. It undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.ACY1 antibody
The ACY1 antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of life sciences. This antibody specifically targets and neutralizes the ACY1 protein, which is involved in several important biological processes.ATF2 antibody
The ATF2 antibody is a polyclonal antibody that specifically targets ATF2, a transcription factor involved in various cellular processes. This antibody can be used for research purposes to study the role of ATF2 in different signaling pathways and gene regulation. It has been shown to have neutralizing activity against ATF2 and can be used to inhibit its function in vitro and in vivo. The ATF2 antibody is highly specific and does not cross-react with other proteins, making it a reliable tool for studying ATF2-mediated processes. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The antibody is formulated with excipients to ensure stability and maintain its functionality over time.GluR4 antibody
The GluR4 antibody is a monoclonal antibody that specifically targets the GluR4 protein, which is a subtype of glutamate receptor. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been used to detect and quantify the expression levels of GluR4 in human serum samples, as well as in different cell types.
RBM45 antibody
RBM45 antibody was raised using the middle region of RBM45 corresponding to a region with amino acids MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFTRBM42 antibody
RBM42 antibody was raised using the middle region of RBM42 corresponding to a region with amino acids RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSSOCS3 antibody
The SOCS3 antibody is a neuroprotective monoclonal antibody that has acidic properties. It is designed to target and bind to fibronectin, insulin, collagen, and other glycosylation sites in the body. This antibody plays a crucial role in regulating the immune response by inhibiting the signaling pathway of cytokines such as interferons and interleukins. By blocking these signals, it helps prevent excessive inflammation and damage to cells and tissues.DYNLL2 antibody
DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYEIF1AX antibody
EIF1AX antibody was raised using the middle region of EIF1AX corresponding to a region with amino acids KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDFLJ22167 antibody
FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVAHUR antibody
The HUR antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody is specifically designed to target and neutralize influenza hemagglutinin, a protein found on the surface of the influenza virus. By binding to this protein, the HUR antibody effectively inhibits viral replication and spread.OATP2/OATP8 antibody
OATP2/OATP8 antibody was raised in mouse using synthetic N-terminus (24 aa) of human organic anion transporter OATP2 coupled to KLH as the immunogen.ETS1 antibody
The ETS1 antibody is a highly specialized monoclonal antibody that has been developed for use in various research applications. It specifically targets and neutralizes the activated form of ETS1, a transcription factor that plays a critical role in regulating gene expression. This antibody has been extensively tested and validated for its specificity and sensitivity.RNASEN antibody
RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIKPLK1 antibody
The PLK1 antibody is a highly specialized monoclonal antibody that targets the polo-like kinase 1 (PLK1) protein. This antibody has been extensively studied and proven to be effective in various research applications.MHC Class II antibody
The MHC Class II antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes MHC Class II molecules. These molecules play a crucial role in the immune response by presenting antigens to T cells, thereby initiating an immune response. The MHC Class II antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It has been shown to effectively stain actin filaments, growth factors, collagen, glycoproteins, fibrinogen, and other cellular components. Additionally, this antibody has been used to study the role of MHC Class II molecules in various biological processes including antigen presentation and cytokine production. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related diseases.SORCS2 antibody
The SORCS2 antibody is a polyclonal antibody that specifically targets the endonuclease SORCS2. This antibody recognizes and binds to the sugar moieties on SORCS2, inhibiting its activity. SORCS2 is involved in various biological processes, including growth factor signaling and regulation of microvessel density. In Life Sciences research, this antibody is commonly used to study the role of SORCS2 in different cellular pathways. It has been shown to neutralize the effects of epidermal growth factor (EGF)-like molecules and hyaluronidase in human serum. Additionally, it has been found to modulate the activity of glutamate receptors and collagen synthesis. The SORCS2 antibody is a valuable tool for researchers studying the function and regulation of this important enzyme in both normal and disease states.DHX30 antibody
DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKDAPOM antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp techniques, it has been proven to inhibit bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Additionally, this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also demonstrates a high affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth. Experience the potent efficacy of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis infections.
CBFA2T2 antibody
CBFA2T2 antibody was raised in mouse using recombinant Core-Binding Factor,Alpha Subunit 2SMAD2 antibody
The SMAD2 antibody is a highly effective tool in the field of Life Sciences. It is an antibody that specifically targets SMAD2, a protein involved in various cellular processes. This antibody has been extensively studied and has shown to have potent protease activity, making it an ideal choice for researchers working on protease-related projects.C6 antibody
The C6 antibody is a highly activated protein that acts as an inhibitor of tumor necrosis factor-alpha (TNF-α). It is widely used in Life Sciences research for its ability to target and neutralize TNF-α, a key player in inflammation and immune response. The C6 antibody has shown promising results in various studies, including its ability to inhibit the binding of TNF-α to its receptors and reduce the production of inflammatory mediators.MTMR12 antibody
MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDDCXR antibody
DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM
