Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
ACT1 antibody
The ACT1 antibody is a polyclonal antibody that specifically targets CD33, a cell surface protein. It has chemokine-neutralizing properties and can be used in various immunoassays and life science research. The ACT1 antibody is also available as a monoclonal antibody and can be used as an inhibitor of TNF-α, a pro-inflammatory cytokine. Additionally, this antibody has the ability to bind to nuclear proteins and neurotrophic factors such as TGF-β1 and natriuretic peptides. With its wide range of applications, the ACT1 antibody is an essential tool for researchers in the field of Life Sciences.PHF5A antibody
The PHF5A antibody is a polyclonal antibody that has inhibiting properties. It is used as an anti-proliferative agent in the field of medicine. This antibody can bind to specific proteins and biomarkers, making it a valuable detection reagent in life sciences research. The PHF5A antibody has been shown to inhibit the activity of certain proteins, such as adeno-associated virus (AAV) and polypeptide, which are involved in cell proliferation. This makes it a promising tool for studying the mechanisms of cell growth and development. Additionally, this antibody can be used to detect autoantibodies and inhibitors that may be present in biological samples. With its wide range of applications, the PHF5A antibody is an essential tool for researchers in various fields.Histone H2B antibody
The Histone H2B antibody is an essential tool in the field of Life Sciences. It is an antigen that specifically recognizes and binds to activated histone H2B, a peptidyl-prolyl isomerase involved in various cellular processes. This antibody has been extensively used in research studies to investigate the role of histone modifications and chromatin structure in gene expression, DNA replication, and repair.Frizzled 5 antibody
The Frizzled 5 antibody is a highly specialized antibody that can be used in various life science research applications. It is available in both polyclonal and monoclonal forms, providing researchers with flexibility in their experiments.
Nanog antibody
Nanog antibody was raised in Mouse using a purified recombinant fragment of Nanog (aa20-166) expressed in E. coli as the immunogen.Claudin 7 antibody
The Claudin 7 antibody is a powerful tool in the field of life sciences. This antibody specifically targets and binds to Claudin 7, an important protein involved in endothelial growth and activation. It can be used in various applications such as immunohistochemistry and polymerase chain reaction (PCR) to study the expression and localization of Claudin 7 in different tissues and cell types.C17ORF71 antibody
C17ORF71 antibody was raised using the middle region of C17Orf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF
PSMA4 antibody
The PSMA4 antibody is a highly specialized antibody used in Life Sciences research. It is colloidal in nature and specifically targets VEGF, c-myc, and other growth factors. This polyclonal antibody has been extensively tested and validated for its efficacy in various applications, including electrophoresis and immunohistochemistry.ANKRD13D antibody
ANKRD13D antibody was raised using the middle region of ANKRD13D corresponding to a region with amino acids ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEEG3BP1 antibody
The G3BP1 antibody is a highly specialized monoclonal antibody that targets and binds to the G3BP1 protein. This protein is involved in various cellular processes, including stress response, RNA metabolism, and cell proliferation. The G3BP1 antibody can be used for research purposes in the field of life sciences, particularly in studies related to insulin signaling, autoimmune diseases such as antiphospholipid syndrome, and cytotoxicity assays.
hnRNP A1 Antibody
The hnRNP A1 Antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown to have significant implications in multiple areas.UBE2F antibody
UBE2F antibody was raised using a synthetic peptide corresponding to a region with amino acids MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCJDP2 antibody
The JDP2 antibody is a highly valuable product in the field of Life Sciences. It is a test compound that has shown promising results as an inhibitor with anti-thrombotic properties. This antibody specifically targets isolated retinal cells and has been proven to be effective in various research studies.Cortactin antibody
The Cortactin antibody is a highly specialized product that plays a crucial role in various scientific and medical applications. This antibody specifically targets the EBNA1 protein, which is involved in the regulation of gene expression and immune response. By binding to EBNA1, this antibody can modulate its activity and potentially inhibit its function.Rotavirus antibody (FITC)
Rotavirus antibody (FITC) was raised in goat using nebraska calf diarrhea virus as the immunogen.GluR1 antibody
The GluR1 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the GluR1 receptor, which plays a crucial role in mediating glutamate signaling in the brain. This antibody has been extensively tested and validated for its high specificity and sensitivity.KIFC2 antibody
KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE
Secernin 2 antibody
Secernin 2 antibody was raised using the N terminal of SCRN2 corresponding to a region with amino acids MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGTFAM129A antibody
FAM129A antibody was raised using the N terminal of FAM129A corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKEMMP1 antibody
The MMP1 antibody is a highly targeted molecule that plays a crucial role in various biological processes. This activated antibody acts as a neutralizing agent, specifically designed for Life Sciences applications. It has the ability to bind and inhibit the activity of matrix metalloproteinase 1 (MMP-1), an enzyme responsible for breaking down fibrinogen and other extracellular matrix proteins.STAT5A antibody
The STAT5A antibody is a test substance that specifically targets the glycoprotein STAT5A. This antibody is widely used in the field of medicine and life sciences to study the activation and function of STAT5A. It has been shown to be effective in various experimental setups, including Western blotting, immunohistochemistry, and flow cytometry.
EXOSC4 antibody
EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
CDKN2B antibody
CDKN2B antibody was raised in rabbit using the middle region of CDKN2B as the immunogenEIF2S1 antibody
EIF2S1 antibody was raised using the C terminal of EIF2S1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAEDInfluenza A antibody (H3N2) (HRP)
Influenza A antibody (H3N2) (HRP) was raised in goat using Influenza A, strain Texas 1/77 (H3N2) as the immunogen.BHMT antibody
BHMT antibody was raised using the N terminal of BHMT corresponding to a region with amino acids AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
LYN antibody
LYN antibody was raised in Mouse using a purified recombinant fragment of LYN expressed in E. coli as the immunogen.GSTK1 antibody
GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLCD61 antibody
The CD61 antibody is a highly specialized antibody-drug that belongs to the class of antibodies known as polyclonal antibodies. It is specifically designed to target a specific antigen, known as CD61, which plays a crucial role in various biological processes including chemokine signaling and immune response. This antibody is widely used in research and diagnostic applications such as immunohistochemistry and flow cytometry.
KAP1 antibody
The KAP1 antibody is a diagnostic reagent that is used to detect and analyze the presence of specific proteins in various biological samples. It is a cytotoxic antibody that targets and neutralizes specific antigens, making it an essential tool in research and diagnostics. The KAP1 antibody can be used in a wide range of applications, including immunohistochemistry, western blotting, and ELISA assays. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. With its high specificity and sensitivity, the KAP1 antibody is widely used in the field of life sciences for studying various cellular processes and signaling pathways. Whether you are working with adipose tissues, mesenchymal stem cells, or oncogene homologs, the KAP1 antibody can provide valuable insights into your research. Trust this specific antibody to deliver accurate results and contribute to advancements in scientific knowledge.SH3BGRL antibody
SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQAEFCAB3 antibody
EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMATDG antibody
The TDG antibody is a highly specific monoclonal antibody that targets the glycan structures on glycoproteins. It is widely used in life sciences research to study the role of glycans in various biological processes. The TDG antibody can be used for applications such as lectin blotting, glycan profiling, and immunohistochemistry. This antibody recognizes a polymorphic epitope that is activated by fatty acid treatment, making it a valuable tool for studying changes in glycosylation patterns. Additionally, the TDG antibody has been shown to interact with epithelial cadherin, suggesting a potential role in cell adhesion and signaling pathways. With its high specificity and sensitivity, this monoclonal antibody is an essential tool for researchers studying glycan-related processes in human proteins.
PRPS2 antibody
PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE
PITPNB antibody
PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKAC3ORF19 antibody
C3ORF19 antibody was raised using the middle region of C3Orf19 corresponding to a region with amino acids RQQWEEEEREALKRPMGPVHYEDIRENEARQLGVGYFAFARDKELRNKQMHOMER1 antibody
HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDRBM35A antibody
RBM35A antibody was raised using the N terminal of RBM35A corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFCDC37 antibody
The CDC37 antibody is a monoclonal antibody that specifically targets CDC37, a protein that plays a crucial role in cell signaling and protein folding. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used for research purposes such as immunoprecipitation, Western blotting, and immunohistochemistry.RAD18 antibody
The RAD18 antibody is a highly specific monoclonal antibody that targets the RAD18 protein. It has been widely used in Life Sciences research and diagnostics. This antibody is derived from mouse monoclonal antibodies and has been extensively characterized for its biophysical properties. The RAD18 antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry. It has shown high affinity and specificity for the target protein in human serum samples. Additionally, this antibody has been utilized in studies involving botulinum toxin research, phosphatase activity assays, and adeno-associated virus-mediated gene delivery. Its ability to bind to the cytosolic protein RAD18 makes it an invaluable tool for researchers working in the field of DNA repair and replication. Whether you're studying cell signaling pathways or investigating disease mechanisms, the RAD18 antibody is an essential reagent to have in your lab arsenal.GLUD2 antibody
GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARNOB1 antibody
NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI
Elk1 antibody
The Elk1 antibody is a monoclonal antibody that targets the Elk1 protein, which plays a crucial role in midbrain dopaminergic function. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.SLC12A1 antibody
SLC12A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Clusterin-Like 1 antibody
Clusterin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAESUSP36 antibody
USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
