Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
ZNF502 antibody
ZNF502 antibody was raised in rabbit using the N terminal of ZNF502 as the immunogenPurity:Min. 95%HMX2 antibody
HMX2 antibody was raised in rabbit using the middle region of HMX2 as the immunogenPurity:Min. 95%POMT1 antibody
POMT1 antibody was raised using the middle region of POMT1 corresponding to a region with amino acids LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPLPurity:Min. 95%Sequestosome 1 antibody
Sequestosome 1 antibody was raised using the middle region of SQSTM1 corresponding to a region with amino acids EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEPurity:Min. 95%GLUT13 antibody
GLUT13 antibody was raised in rabbit using a 16 amino acid peptide from human GT13 as the immunogen.Purity:Min. 95%C1ql1 antibody
C1ql1 antibody was raised in rabbit using the N terminal of C1ql1 as the immunogen
Purity:Min. 95%SLC25A38 antibody
SLC25A38 antibody was raised using the middle region of SLC25A38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTRPurity:Min. 95%EBAG9 antibody
EBAG9 antibody was raised in rabbit using the C terminal of EBAG9 as the immunogenPurity:Min. 95%Histone H3 antibody
The Histone H3 antibody is a monoclonal antibody that specifically targets histone H3, a protein involved in the packaging of DNA into chromatin. This antibody is commonly used in research studies to investigate histone modifications and their impact on gene expression. It is particularly useful for techniques such as chromatin immunoprecipitation assay (ChIP) which allows researchers to study the interactions between proteins and DNA. The Histone H3 antibody has been extensively validated and is known for its high specificity and sensitivity. It has been successfully used in various applications including Western blotting, immunofluorescence, and immunohistochemistry. Researchers can rely on this antibody to accurately detect histone H3 acetylation levels and gain insights into epigenetic regulation of gene expression.Purity:Min. 95%NDUFS3 antibody
NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Purity:Min. 95%MELK antibody
The MELK antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as Maternal Embryonic Leucine Zipper Kinase (MELK). This glycoprotein plays a crucial role in various cellular processes, including cell division, proliferation, and differentiation.Purity:Min. 95%NCAPH antibody
NCAPH antibody was raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLLPurity:Min. 95%TSHR antibody
TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSPurity:Min. 95%Tropomodulin 2 antibody
Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIPurity:Min. 95%DGKH antibody
DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMWPurity:Min. 95%PPP2R1A antibody
PPP2R1A antibody was raised using a synthetic peptide corresponding to a region with amino acids KAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPPurity:Min. 95%GOLGA7 antibody
GOLGA7 antibody was raised in rabbit using the N terminal of GOLGA7 as the immunogenPurity:Min. 95%TRIM23 antibody
TRIM23 antibody was raised in rabbit using the middle region of TRIM23 as the immunogenPurity:Min. 95%IL11R alpha antibody
IL11R alpha antibody was raised using the N terminal of IL11RA corresponding to a region with amino acids QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADPurity:Min. 95%PILRA antibody
PILRA antibody was raised using the N terminal of PILRA corresponding to a region with amino acids IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNPurity:Min. 95%CD27 antibody
CD27 antibody was raised in rabbit using the C terminal of CD27 as the immunogenPurity:Min. 95%BECN1 antibody
BECN1 antibody was raised in rabbit using the middle region of BECN1 as the immunogenPurity:Min. 95%SLC26A1 antibody
SLC26A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ACCSPPVRDILSRGGFLGEGPGDTAEEEQLFLSVHDAVQTARARHRELEAPurity:Min. 95%LYVE1 antibody
LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.Purity:Min. 95%SNIP1 antibody
SNIP1 antibody was raised in rabbit using the middle region of SNIP1 as the immunogen
Purity:Min. 95%SLC41A3 antibody
SLC41A3 antibody was raised using the C terminal of SLC41A3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFIPurity:Min. 95%TMEM63B antibody
TMEM63B antibody was raised using the middle region of TMEM63B corresponding to a region with amino acids VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITAPurity:Min. 95%AGXT2L2 antibody
AGXT2L2 antibody was raised in rabbit using the C terminal of AGXT2L2 as the immunogen
Purity:Min. 95%EMX1 antibody
EMX1 antibody was raised in rabbit using the middle region of EMX1 as the immunogenPurity:Min. 95%SERPINE1 antibody
SERPINE1 antibody was raised using the N terminal of SERPINE1 corresponding to a region with amino acids VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQPurity:Min. 95%DRGX antibody
DRGX antibody was raised in rabbit using the N terminal of DRGX as the immunogen
Purity:Min. 95%C5ORF4 antibody
C5ORF4 antibody was raised using the N terminal Of C5Orf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ
Purity:Min. 95%CYP3A43 antibody
CYP3A43 antibody was raised using the middle region of CYP3A43 corresponding to a region with amino acids ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIPurity:Min. 95%AXL antibody
AXL antibody was raised in rabbit using the C terminal of AXL as the immunogen
Purity:Min. 95%SFTPC antibody
SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIPurity:Min. 95%Csrp2 antibody
Csrp2 antibody was raised in rabbit using the middle region of Csrp2 as the immunogenPurity:Min. 95%SDF1 beta antibody
SDF1 beta antibody was raised in goat using highly pure recombinant human SDF-1-beta as the immunogen.Purity:Min. 95%GOLGB1 antibody
GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKEPurity:Min. 95%MGC51025 antibody
MGC51025 antibody was raised in rabbit using the C terminal of MGC51025 as the immunogenPurity:Min. 95%NRBP1 antibody
NRBP1 antibody was raised in rabbit using the N terminal of NRBP1 as the immunogenPurity:Min. 95%GRIN2B antibody
GRIN2B antibody was raised using the middle region of GRIN2B corresponding to a region with amino acids RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKRPurity:Min. 95%MGC46336 antibody
MGC46336 antibody was raised in rabbit using the N terminal of MGC46336 as the immunogenPurity:Min. 95%SEMA4F antibody
SEMA4F antibody was raised using the N terminal of SEMA4F corresponding to a region with amino acids PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADLPurity:Min. 95%EG VEGF antibody
EG VEGF antibody was raised in goat using highly pure recombinant human EG-VEGF as the immunogen.Purity:Min. 95%DBX2 antibody
DBX2 antibody was raised in rabbit using the N terminal of DBX2 as the immunogenPurity:Min. 95%BMP2 antibody
BMP2 antibody was raised in rabbit using highly pure recombinant human BMP-2 as the immunogen.Purity:Min. 95%Lamin B Receptor antibody
Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL
Purity:Min. 95%ACT antibody
ACT antibody was raised in rabbit using N terminus of ACT as the immunogen.Purity:Min. 95%Oncostatin M antibody
Oncostatin M antibody was raised in rabbit using highly pure recombinant human oncostatin M as the immunogen.Purity:Min. 95%PHYHIPL antibody
PHYHIPL antibody was raised in rabbit using the C terminal of PHYHIPL as the immunogenPurity:Min. 95%NHLH1 antibody
NHLH1 antibody was raised in rabbit using the middle region of NHLH1 as the immunogenPurity:Min. 95%ZNF71 antibody
ZNF71 antibody was raised in rabbit using the middle region of ZNF71 as the immunogenPurity:Min. 95%Neuropilin antibody
Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME
Purity:Min. 95%XYLT2 antibody
XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMWPurity:Min. 95%B3gat2 antibody
B3gat2 antibody was raised in rabbit using the C terminal of B3gat2 as the immunogenPurity:Min. 95%PIGT antibody
PIGT antibody was raised using the N terminal of PIGT corresponding to a region with amino acids PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHLPurity:Min. 95%Atp10d antibody
Atp10d antibody was raised in rabbit using the middle region of Atp10d as the immunogenPurity:Min. 95%SLC39A4 antibody
SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTLPurity:Min. 95%Thra antibody
Thra antibody was raised in rabbit using the C terminal of Thra as the immunogen
Purity:Min. 95%TRIM27 antibody
TRIM27 antibody was raised in rabbit using the middle region of TRIM27 as the immunogenPurity:Min. 95%Zfp275 antibody
Zfp275 antibody was raised in rabbit using the middle region of Zfp275 as the immunogenPurity:Min. 95%GCP2 antibody
GCP2 antibody was raised in rabbit using highly pure recombinant human GCP-2 as the immunogen.Purity:Min. 95%BMP6 antibody
BMP6 antibody was raised in rabbit using the N terminal of BMP6 as the immunogenPurity:Min. 95%BBS2 antibody
BBS2 antibody was raised in rabbit using the N terminal of BBS2 as the immunogenPurity:Min. 95%PIMT antibody
PIMT antibody was raised in rabbit using residues 839-853 of the C terminus of the PIMT protein as the immunogen.Purity:Min. 95%DCP1B antibody
DCP1B antibody was raised in rabbit using the N terminal of DCP1B as the immunogenPurity:Min. 95%ARL6IP2 antibody
ARL6IP2 antibody was raised using the C terminal of ARL6IP2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQPurity:Min. 95%PIGK antibody
PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVPurity:Min. 95%SLC20A1 antibody
SLC20A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLPurity:Min. 95%LAMP1 antibody
LAMP1 antibody was raised in rabbit using the N terminal of LAMP1 as the immunogenPurity:Min. 95%4EBP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target and treat tuberculosis infections by effectively inhibiting bacterial growth. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, making it a bactericidal agent. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.Purity:Min. 95%Ctsd antibody
Ctsd antibody was raised in rabbit using the C terminal of Ctsd as the immunogenPurity:Min. 95%BVES antibody
BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSPurity:Min. 95%LUC7L antibody
LUC7L antibody was raised in rabbit using the middle region of LUC7L as the immunogen
Purity:Min. 95%DNAI2 antibody
DNAI2 antibody was raised in rabbit using the N terminal of DNAI2 as the immunogenPurity:Min. 95%Midkine antibody
Midkine antibody was raised in rabbit using highly pure recombinant human Midkine as the immunogen.Purity:Min. 95%Pex2 antibody
Pex2 antibody was raised in rabbit using the C terminal of Pex2 as the immunogenPurity:Min. 95%SLC27A4 antibody
SLC27A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKLPurity:Min. 95%GABRR1 antibody
GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHPurity:Min. 95%Fibronectin antibody (Prediluted for IHC)
Rabbit polyclonal Fibronectin antibody (Prediluted for IHC)Purity:Min. 95%RBM9 antibody
RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPTPurity:Min. 95%PNMA2 antibody
PNMA2 antibody was raised in rabbit using the middle region of PNMA2 as the immunogenPurity:Min. 95%C19ORF15 antibody
C19ORF15 antibody was raised using the C terminal Of C19Orf15 corresponding to a region with amino acids FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDKPurity:Min. 95%NID2 antibody
NID2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMVPurity:Min. 95%TLR4 antibody
TLR4 antibody was raised in rabbit using the middle region of TLR4 as the immunogenPurity:Min. 95%HELT antibody
HELT antibody was raised in rabbit using the middle region of HELT as the immunogenPurity:Min. 95%HTR3A antibody
HTR3A antibody was raised in rabbit using the middle region of HTR3A as the immunogenPurity:Min. 95%Aqp2 antibody
Aqp2 antibody was raised in rabbit using the middle region of Aqp2 as the immunogenPurity:Min. 95%TIMP4 antibody
TIMP4 antibody was raised in rabbit using the middle region of TIMP4 as the immunogenPurity:Min. 95%Dynactin 2 antibody
Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHIPurity:Min. 95%DOCK2 antibody
DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA
Purity:Min. 95%GIMAP5 antibody
GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLPurity:Min. 95%
