Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75594 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Caspase 1 antibody
Caspase 1 antibody is a polyclonal antibody that has been specifically designed for the detection and analysis of caspase-1 activation. Caspase-1 is an enzyme that plays a crucial role in the inflammatory response and programmed cell death. This antibody is highly specific and has been extensively tested to ensure accurate and reliable results.CDK9 antibody
The CDK9 antibody is a growth factor that targets specific acid residues to inhibit the activity of cyclin-dependent kinase 9 (CDK9). This monoclonal antibody is designed to specifically bind to CDK9 and prevent its interaction with other proteins, thereby disrupting protein-protein interactions necessary for cell growth and proliferation. The CDK9 antibody can be used in various research applications, such as Western blotting, immunoprecipitation, and immunofluorescence. It has also shown potential therapeutic benefits in the treatment of diseases characterized by abnormal cell growth, such as cancer. Additionally, this antibody has been studied for its anti-angiogenic properties, which may contribute to its ability to inhibit tumor growth by preventing the formation of new blood vessels. With its high specificity and low-molecular-weight design, the CDK9 antibody offers a powerful tool for studying protein function and developing targeted therapies.SH2B3 antibody
The SH2B3 antibody is a powerful tool in Life Sciences research. This antibody is specifically designed to target and bind to the SH2B3 protein, which plays a crucial role in various cellular processes. It can be used in antiviral studies to investigate the interaction between SH2B3 and viral proteins. Additionally, this antibody is useful in studying the effects of irradiation, chemotherapy, and other hematopoietic or antitumor drugs on SH2B3 expression and function. As a monoclonal antibody, it offers high specificity and sensitivity for detecting SH2B3 both intra- and extracellularly. Researchers can rely on this reliable reagent to advance their understanding of the intricate mechanisms involving the SH2B3 protein.PES1 antibody
PES1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPEPARP2 antibody
PARP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
Diphtheria toxin antibody
Diphtheria toxin antibody was raised in mouse using diphtheria toxin and anatoxin as the immunogen.
Donkey anti Mouse IgG (H + L) (HRP)
Donkey anti-Mouse IgG (H + L) (HRP) was raised in donkey using purified Mouse IgG (H&L) as the immunogen.RBPMS2 antibody
RBPMS2 antibody was raised using the middle region of RBPMS2 corresponding to a region with amino acids ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAPSCF antibody
SCF antibody was raised in mouse using highly pure recombinant human SCF as the immunogen.Cyclin E1 antibody (Thr395)
Rabbit polyclonal Cyclin E1 antibody (Thr395), application WB, IHC, ELISASMAD1 antibody
The SMAD1 antibody is a highly specialized monoclonal antibody that specifically targets and binds to the activated form of SMAD1. This antibody is widely used in various fields of Life Sciences research, particularly in studies related to oncostatin, e-cadherin, anti-mesothelin, and basic protein. It has been proven to be effective in detecting and quantifying the expression levels of e-cadherin in different cell types.
RCHY1 antibody
RCHY1 antibody was raised using the N terminal of RCHY1 corresponding to a region with amino acids KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYCDC6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. In addition, it has been proven to have a high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.
RTN3 antibody
The RTN3 antibody is a powerful tool in the field of anti-angiogenesis. It acts as an inhibitor, making it ideal for both treatment and prophylaxis purposes. This antibody is available in both polyclonal and monoclonal forms, providing flexibility for different research needs.GPR87 antibody
GPR87 antibody was raised using the middle region of GPR87 corresponding to a region with amino acids NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITLASL antibody
ASL antibody was raised using the N terminal of ASL corresponding to a region with amino acids GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAEAPPBP2 antibody
APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLNKRT14 antibody
The KRT14 antibody is a growth factor that plays a crucial role in various biological processes. It is an autoantibody that specifically targets and activates KRT14, which is a multidrug resistance protein. This antibody has shown promising results in combination with other therapies such as trastuzumab, leading to increased efficacy in the treatment of certain cancers. Additionally, the KRT14 antibody has been found to reduce viscosity and enhance drug delivery due to its ability to bind to amino groups and inhibit interleukin-6 activity. This monoclonal antibody offers a targeted approach for treating diseases associated with KRT14 dysregulation, making it a valuable tool in medical research and therapy development.ACTB antibody
The ACTB antibody is a highly specialized monoclonal antibody that targets the ACTB protein. This protein plays a crucial role in various biological processes, including cell structure and movement. The ACTB antibody specifically recognizes and binds to the ACTB protein, allowing for its detection and analysis in various experimental settings.BLM antibody
The BLM antibody is a monoclonal antibody that is widely used in Life Sciences research. It has the ability to lyse cells and neutralize the effects of certain proteins, such as collagen and tumor necrosis factor-alpha (TNF-α). This antibody can also be used to study the role of growth factors and other antibodies, such as polyclonal antibodies, trastuzumab, and adalimumab. Additionally, it has been shown to interact with various molecules, including TGF-beta, chemokines, and epidermal growth factors. The BLM antibody is a valuable tool for researchers in various fields who are interested in studying protein interactions and their effects on cellular processes.BMP4 antibody
BMP4 antibody was raised in Mouse using a purified recombinant fragment of human BMP4 expressed in E. coli as the immunogen.HER3 antibody
The HER3 antibody is a monoclonal antibody known as trastuzumab, which belongs to the class of multidrug antibodies. It specifically targets and inhibits the growth factor receptor HER3, which is involved in various cellular processes such as cell proliferation and survival. The HER3 antibody blocks the interaction between HER3 and other growth factors like hepatocyte growth factor and endothelial growth factor, thereby preventing downstream signaling pathways that promote tumor growth.CDC2 antibody
The CDC2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is widely recognized for its exceptional binding properties and specificity towards CDC2, a protein involved in cell division regulation. This antibody has been extensively tested and validated in various research applications.STX17 antibody
The STX17 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to STX17, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in research applications.Diphtheria toxin antibody
Diphtheria toxin antibody was raised in mouse using diphtheria toxin and anatoxin as the immunogen.
CD54 antibody
The CD54 antibody is a monoclonal antibody that targets the CD54 protein, also known as intercellular adhesion molecule-1 (ICAM-1). It is commonly used in life sciences research to study cell growth and signaling pathways. The CD54 antibody binds specifically to the CD54 protein, which plays a crucial role in cell adhesion and immune response. By blocking the interaction between CD54 and its ligands, this antibody can inhibit various cellular processes such as inflammation and tumor progression. Additionally, the CD54 antibody has been used in studies investigating the effects of growth factors, steroids, dopamine, and kinase inhibitors on cell behavior. Its versatility makes it an essential tool for researchers in various fields of study within the life sciences.SRR antibody
The SRR antibody is a highly specific monoclonal antibody that targets the serine protease SRR. This antibody is widely used in various assays and research studies in the field of Life Sciences. It has been proven to effectively inhibit the activity of SRR, leading to lysis of targeted cells. The SRR antibody is commonly used in drug development as an erbb2 inhibitor and has shown promising results in preclinical studies. Additionally, this antibody has been used in research involving interleukin signaling pathways and phosphatase regulation. Its high affinity and specificity make it an ideal tool for studying the role of SRR in various biological processes. The SRR antibody is available for purchase and can be used in both in vitro and in vivo experiments using human serum or human hepatocytes.
EML1 antibody
EML1 antibody was raised using the C terminal of EML1 corresponding to a region with amino acids YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVIClusterin antibody
Clusterin antibody was raised in mouse using recombinant human Clusterin (1-333aa) purified from E. coli as the immunogen.CD1A antibody
The CD1A antibody is a highly specialized monoclonal antibody that targets the elastase protein. It has been extensively biotinylated for easy detection and analysis. This antibody specifically binds to the amino-terminal region of CD1A, a cell surface glycoprotein found on human hepatocytes. The CD1A antibody is widely used in various assays and research applications, including hybridization, ELISA, and immunohistochemistry. It can also be used for the detection and quantification of CD1A in biological samples. With its high specificity and sensitivity, this CD1A antibody is an essential tool for researchers studying the role of CD1A in various physiological processes.
MYT1 antibody
The MYT1 antibody is a powerful tool in Life Sciences research. It specifically targets and detects the kinase activity of MYT1, an essential protein involved in various cellular processes. This polyclonal antibody can be used in a wide range of applications, including phosphorylation assays and substrate identification. With its high specificity and sensitivity, the MYT1 antibody provides reliable results for researchers studying protein kinases. Trust this antibody to deliver accurate data and advance your scientific discoveries.BRAF antibody
The BRAF antibody is a highly specific monoclonal antibody used for immunohistochemical detection in Life Sciences. It is commonly used in research and industrial applications for its ability to detect the activated form of the oncogene homolog B-Raf, which is involved in various cellular processes. This antibody has a high affinity and specificity towards the target protein, making it an ideal tool for studying the expression and localization of BRAF in different tissues and cell types. Its use in immunoassays allows for accurate quantification of BRAF levels, providing valuable insights into its role in cancer development and progression. The BRAF antibody can be utilized by researchers and scientists working in various fields, including oncology, molecular biology, and drug discovery. With its reliable performance and consistent results, this antibody is a valuable asset for any laboratory or research facility aiming to investigate the function of BRAF or develop targeted therapies against BRAF-driven cancers.Raf1 antibody
The Raf1 antibody is a powerful tool in Life Sciences research. It specifically targets the Raf1 protein, an oncogene homolog that plays a crucial role in cell signaling pathways. This monoclonal antibody binds to Raf1 with high affinity, allowing for precise detection and analysis of its expression levels in various samples.RUFY1 antibody
RUFY1 antibody was raised using the C terminal of RUFY1 corresponding to a region with amino acids QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLIL23 antibody
IL23 antibody is a cytotoxic antibody that belongs to the class of monoclonal antibodies. It is used in Life Sciences research for various applications, including the study of actin filaments and the development of therapeutic inhibitors. IL23 antibody has been shown to have high affinity for its target, making it an effective tool in experiments involving human serum or other biomolecules. This antibody can be used in combination with other antibodies, such as trastuzumab or anti-dnp antibodies, to enhance their cytotoxic effects. IL23 antibody also shows potential as a treatment for certain diseases, including cancer and autoimmune disorders, due to its ability to inhibit the activity of specific proteins, such as epidermal growth factor or anti-cd33 antibody.PECI antibody
PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKGTF2IRD1 antibody
GTF2IRD1 antibody was raised in mouse using recombinant Gtf2I Repeat Domain Containing 1 (Gtf2Ird1)CCNB1 antibody
CCNB1 antibody was raised in Mouse using a purified recombinant fragment of human CCNB1 expressed in E. coli as the immunogen.Akt antibody (Ser473)
Akt, also known as Protein Kinase B (PKB), is a vital cellular signaling protein that governs key processes such as cell growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt pathway, a major signaling route activated by growth factors and hormones like insulin to promote cell survival and growth. When activated, Akt is recruited to the cell membrane and phosphorylated by kinases, including PDK1, which fully activates it. Once active, Akt influences various downstream pathways to inhibit apoptosis, support cell growth via the mTOR pathway, and enhance glucose metabolism, which is crucial for insulin response.In diseases like cancer and diabetes, Akt’s role is particularly significant. Cancer frequently involves dysregulation of the Akt pathway, often through mutations in pathway components like PI3K, PTEN, or Akt itself, leading to increased cell survival, unchecked growth, and resistance to treatment. In diabetes, insulin resistance reduces Akt pathway activity, impairing glucose uptake and raising blood glucose levels. Because of these regulatory effects on cell growth and metabolism, the Akt pathway is a central target in therapeutic research for treating conditions where its influence is disrupted.CDK4 antibody
The CDK4 antibody is a powerful tool used in immunohistochemistry to study the G1 phase of the cell cycle. It is a monoclonal antibody that specifically targets cyclin-dependent kinase 4 (CDK4), a key regulator of cell division. By inhibiting CDK4, this antibody helps researchers understand the role of this kinase inhibitor in cell cycle progression and its potential as a therapeutic target.ATP6V1E2 antibody
ATP6V1E2 antibody was raised using the middle region of ATP6V1E2 corresponding to a region with amino acids LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVMUTYH antibody
The MUTYH antibody is a highly specialized serum marker used in the field of Life Sciences. It is an antibody that specifically targets and binds to the methyl transferase enzyme known as MUTYH. This enzyme plays a crucial role in DNA repair processes, ensuring the integrity of our genetic material.SFRS2B antibody
SFRS2B antibody was raised using the middle region of SFRS2B corresponding to a region with amino acids YRESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSA
