Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75594 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MMP19 antibody
MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWROSR1 antibody
The OSR1 antibody is a powerful tool in the field of life sciences. It is an interferon and glucagon-neutralizing antibody that has been extensively used in various research studies. This polyclonal antibody specifically targets OSR1 (oxidative stress-responsive 1) protein, which plays a crucial role in cellular processes related to growth, development, and homeostasis.ACLY antibody
ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPATEC antibody
TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGNOX4 antibody
The NOX4 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the NOX4 protein isoforms. This monoclonal antibody is widely used in research laboratories and pharmaceutical companies for various applications.RAC1 antibody
RAC1 antibody was raised in mouse using recombinant protein containing the full length human rac1 as the immunogen.AMDHD1 antibody
AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLVC15ORF26 antibody
C15ORF26 antibody was raised using the C terminal Of C15Orf26 corresponding to a region with amino acids LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLVNKX3A antibody
NKX3A antibody was raised in Mouse using a purified recombinant fragment of human NKX3A expressed in E. coli as the immunogen.Vimentin antibody
Vimentin antibody was raised in sheep using purified recombinant human vimentin produced in bacteria as the immunogen.
hnRNP A1 antibody
The hnRNP A1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically binds to hnRNP A1, which is one of the key binding proteins involved in various cellular processes. This antibody has been extensively studied for its role in regulating gene expression, RNA processing, and protein synthesis.
PDI antibody
The PDI antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has been extensively studied and proven to be effective in targeting tumor necrosis factor-alpha (TNF-α), a growth factor associated with inflammation and immune response. This antibody has also shown promising results in inhibiting multidrug resistance, making it an important tool in cancer research.
TCF3 antibody
TCF3 antibody was raised in Mouse using a purified recombinant fragment of human TCF3 expressed in E. coli as the immunogen.DAXX antibody
DAXX antibody was raised in Mouse using a purified recombinant fragment of human DAXX expressed in E. coli as the immunogen.CNOT2 antibody
The CNOT2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of CNOT2, a key protein involved in epidermal growth and endothelial growth factor signaling pathways. This antibody has been extensively studied and shown to have potent anti-HER2 activity, making it an ideal candidate for targeted therapy against HER2-positive cancers.TPTE antibody
TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL
Cathepsin D antibody
The Cathepsin D antibody is a highly effective and specific monoclonal antibody that targets the active enzyme Cathepsin D. This antibody has been extensively studied in the field of Life Sciences and has shown great potential for various applications. It binds specifically to Cathepsin D, inhibiting its enzymatic activity and preventing it from binding to its receptors.CACNB2 antibody
CACNB2 antibody was raised using the N terminal of CACNB2 corresponding to a region with amino acids IQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVRCAD antibody
The CAD antibody is a highly versatile biomolecule that plays a crucial role in various Life Sciences applications. This polyclonal antibody specifically targets and neutralizes CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase), an essential enzyme involved in the de novo pyrimidine biosynthesis pathway.SH3KBP1 antibody
SH3KBP1 antibody was raised using the N terminal of SH3KBP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSFKBPL antibody
FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLP19 INK4d antibody
The P19 INK4d antibody is a polyclonal antibody that specifically targets human serum albumin. It recognizes and binds to the hormone peptide, glycation, and EGF-like domains of human serum albumin. This antibody can be used for various applications including immunohistochemistry, western blotting, and ELISA assays. It has been extensively characterized and validated for its specificity and sensitivity. The P19 INK4d antibody is also available as a monoclonal antibody for more specific targeting of vasoactive intestinal peptide and other growth factors. It can be purified using chromatographic techniques and can be used for neutralizing chemokine activity in various biological systems.HIST1H2AH antibody
HIST1H2AH antibody was raised in rabbit using the C terminal of HIST1H2AH as the immunogenZBTB7B antibody
ZBTB7B antibody was raised in Mouse using a purified recombinant fragment of human ZBTB7B expressed in E. coli as the immunogen.GFR alpha antibody
The GFR alpha antibody is a highly effective antiviral agent that targets low-density lipoprotein lipase and transferrin. This polyclonal antibody is specifically designed to bind to collagen and electrodes, making it an ideal tool for various research applications in the life sciences field. Additionally, this monoclonal antibody has shown promising results in inhibiting interferon production and neutralizing viral activity. With its ability to interact with chimeric proteins and fatty acids, the GFR alpha antibody offers a versatile solution for studying immune responses and developing therapeutic interventions. It is extensively tested and validated in human serum samples, ensuring reliable and accurate results. Choose this exceptional antibody for your research needs today.Keratin 18 antibody
The Keratin 18 antibody is a highly specialized antibody that specifically targets and binds to Keratin 18, a protein involved in cellular structure and growth. This antibody has been extensively studied and proven to be effective in various applications within the field of Life Sciences.ITGBL1 antibody
ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERRp53 antibody
p53 antibody is an antiviral agent that targets the p53 protein, a key regulator of cell division and apoptosis. This antibody binds to the p53 protein and inhibits its function, preventing viral replication and spread. Additionally, it has been shown to have chemokine-like properties, attracting mesenchymal stem cells to the site of infection for tissue repair. In Life Sciences, this antibody is widely used in research and diagnostic applications for studying intraocular diseases and detecting autoantibodies. It can also be used as a tool for telomerase inhibition or as an inhibitor of fibroin production. The p53 antibody is available in both polyclonal and monoclonal forms, with neutralizing activity against the p53 antigen. Its high specificity ensures reliable results in antigen-antibody reactions. Choose the p53 antibody for your research needs and unlock new insights into cellular processes and disease mechanisms.PNPLA5 antibody
PNPLA5 antibody was raised using the N terminal of PNPLA5 corresponding to a region with amino acids LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL
C12ORF42 antibody
C12ORF42 antibody was raised using the N terminal Of C12Orf42 corresponding to a region with amino acids PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPKFAK antibody
The FAK antibody is a powerful tool in the field of Life Sciences. This steroid-based antibody is designed to target and neutralize specific proteins, such as anti-mesothelin antibodies, in order to study their function and potential therapeutic applications. The FAK antibody has been shown to inhibit the growth and proliferation of cancer cells by blocking the activity of epidermal growth factor (EGF) and its receptor. Additionally, this antibody has cytotoxic properties, making it an effective tool for targeted cell killing in research experiments. The FAK antibody is highly reactive and can be used to detect and quantify the presence of specific proteins in samples, such as human serum or tissue extracts. Its specificity and sensitivity make it an essential tool for researchers working in various fields of study, including oncology, immunology, and cell biology.TAP1 Antibody
The TAP1 Antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the TAP1 protein isoforms, which play a crucial role in antigen presentation and immune response. By binding to the TAP1 protein, this antibody allows for the detection and analysis of threonine phosphorylation and other post-translational modifications.Myb antibody
The Myb antibody is a polyclonal antibody that specifically targets annexin A2. It is commonly used in research and laboratory settings to study the function and regulation of annexin A2. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and immunofluorescence assays. The Myb antibody has been proven to be highly specific and sensitive, providing reliable results in experiments. It can also be used in combination with other antibodies or inhibitors to study the interaction between annexin A2 and other molecules, such as chemokines or glucagon. Whether you are studying cardiomyocytes or conducting multidrug resistance assays, the Myb antibody is an essential tool for your research needs.SOX9 antibody
The SOX9 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly used for immunoassays and research purposes. This antibody specifically targets the SOX9 protein, which is a critical growth factor involved in various cellular processes. The SOX9 antibody can be utilized to study the expression and localization of this protein in different tissues and cell types.ESD antibody
ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
TUBB3 antibody
TUBB3 antibody was raised in Mouse using a purified recombinant fragment of human TUBB3 expressed in E. coli as the immunogen.CD68 antibody
The CD68 antibody is a monoclonal antibody that specifically targets the CD68 protein. CD68 is a glycoprotein that is predominantly expressed in macrophages and monocytes. This antibody has been widely used in Life Sciences research to study the activation of macrophages and the role of CD68 in various cellular processes.MPK6 antibody
The MPK6 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the tyrosine kinase receptor and is commonly used in studies related to growth factors and cytotoxicity. This antibody has been shown to bind to carbonyl reductase and has potential applications in immunohistochemistry experiments. Additionally, it can be used in antibody-drug conjugates for targeted therapy. The MPK6 antibody is highly specific and reliable, making it an essential tool for researchers in the field of Life Sciences.ETV6 antibody
ETV6 antibody is a highly specialized antibody that targets the ETV6 protein, which is involved in regulating cell growth and development. It has been shown to inhibit the activity of this growth factor in various biological systems, including liver microsomes. The ETV6 antibody can be used as an inhibitor in research studies investigating the role of ETV6 in different cellular processes, such as collagen synthesis or TGF-β1 signaling. This product is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific experimental needs. The ETV6 antibody belongs to the category of antibodies used in life sciences research and has been extensively validated for its specificity and reliability. In addition to its applications in basic research, this antibody may also have potential therapeutic uses, particularly in targeting diseases involving abnormal ETV6 activity, such as certain types of cancers or neurological disorders.ERAB antibody
The ERAB antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets c-myc, a protein involved in various cellular processes such as cell growth and proliferation. The ERAB antibody can be used for applications such as immunohistochemistry, immunofluorescence, and Western blotting to detect the presence and localization of c-myc in different tissues and cell types.NMDAR1 antibody
The NMDAR1 antibody is a diagnostic reagent that belongs to the class of antibodies. It has excellent pharmacokinetic properties and is commonly used in Life Sciences research. The antibody is designed to specifically bind to NMDAR1, a biomolecule involved in various cellular processes such as synaptic plasticity and learning. It can be used for applications such as immunohistochemistry, Western blotting, and flow cytometry.
Fibrinogen antibody (HRP)
Fibrinogen antibody (HRP) was raised in sheep using human factor VIIIc as the immunogen.PIK3R3 antibody
The PIK3R3 antibody is a powerful tool in the field of biomedical research. It specifically targets lyso-gb1, an antigen that plays a crucial role in various cellular processes. This polyclonal antibody can be used to detect and study the expression of lyso-gb1 in different tissues and cell types.
C20ORF160 antibody
C20ORF160 antibody was raised using the N terminal Of C20Orf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLDCDC2 antibody
DCDC2 antibody was raised using the middle region of DCDC2 corresponding to a region with amino acids KGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNS
IKZF3 antibody
The IKZF3 antibody is a highly specialized monoclonal antibody that has been developed for the detection and treatment of various medical conditions. This antibody specifically targets IKZF3, a protein that plays a crucial role in regulating immune responses and cell growth.GFAP antibody
The GFAP antibody is a highly specialized antibody used in Life Sciences research. It is produced by immunizing animals with bovine γ-globulin and generating polyclonal or monoclonal antibodies. This antibody specifically targets glial fibrillary acidic protein (GFAP), which is expressed in astrocytes, a type of glial cell in the central nervous system.GJC1 antibody
GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFP2RX2 antibody
P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHPMM1 antibody
PMM1 antibody was raised using the N terminal of PMM1 corresponding to a region with amino acids MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV
