Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75594 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
D4S234E antibody
D4S234E antibody was raised in rabbit using the N terminal of D4S234E as the immunogenPurity:Min. 95%GRHL3 antibody
GRHL3 antibody was raised in rabbit using the C terminal of GRHL3 as the immunogenPurity:Min. 95%MIER2 antibody
MIER2 antibody was raised in rabbit using the middle region of MIER2 as the immunogen
Purity:Min. 95%ABCF2 antibody
ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIPurity:Min. 95%NF kappaB p65 antibody
The NF kappaB p65 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to the NF kappaB p65 protein, which plays a crucial role in various cellular processes such as hepatocyte growth, endothelial growth, and collagen synthesis.Purity:Min. 95%FUBP3 antibody
FUBP3 antibody was raised in rabbit using the N terminal of FUBP3 as the immunogen
Purity:Min. 95%CGB antibody
CGB antibody was raised in rabbit using the C terminal of CGB as the immunogenPurity:Min. 95%ZNF251 antibody
ZNF251 antibody was raised in rabbit using the middle region of ZNF251 as the immunogenPurity:Min. 95%ZNF185 antibody
ZNF185 antibody was raised in rabbit using the N terminal of ZNF185 as the immunogen
Purity:Min. 95%GATA1 antibody
GATA1 antibody was raised in rabbit using residues 211-225 [ATPLWRRDRTGHYL] of the ~42 kDa human protein as the immunogen.Purity:Min. 95%ESE1 antibody
ESE1 antibody was raised in rabbit using N terminal sequence MAATCEISNIFSNYFS and C terminal sequence SSGWKEEEVLQSRN of the human ESE-1 protein as the immunogen.Purity:Min. 95%SLC25A20 antibody
SLC25A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLPurity:Min. 95%ZNF252 antibody
ZNF252 antibody was raised in rabbit using the middle region of ZNF252 as the immunogenPurity:Min. 95%Ribophorin I antibody
Ribophorin I antibody was raised using the middle region of RPN1 corresponding to a region with amino acids AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK
Purity:Min. 95%CEACAM16 antibody
CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCPurity:Min. 95%SPDEF antibody
SPDEF antibody was raised in rabbit using the C terminal of SPDEF as the immunogenPurity:Min. 95%C1orf25 antibody
C1orf25 antibody was raised in rabbit using the middle region of C1ORF25 as the immunogen
Purity:Min. 95%PIGW antibody
PIGW antibody was raised using the middle region of PIGW corresponding to a region with amino acids IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV
Purity:Min. 95%Hspbp1 antibody
Hspbp1 antibody was raised in rabbit using the C terminal of Hspbp1 as the immunogenPurity:Min. 95%LMBR1 antibody
LMBR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGQDEVSAREQHFHSQVRESTICFLLFAILYVVSYFIITRYKRKSDEQEPurity:Min. 95%P2rx2 antibody
P2rx2 antibody was raised in rabbit using the middle region of P2rx2 as the immunogenPurity:Min. 95%MAP4K2 antibody
MAP4K2 antibody was raised using the N terminal of MAP4K2 corresponding to a region with amino acids TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDRPurity:Min. 95%hCG_20426 antibody
hCG_20426 antibody was raised in rabbit using the N terminal of HCG_20426 as the immunogenPurity:Min. 95%ZNF71 antibody
ZNF71 antibody was raised in rabbit using the N terminal of ZNF71 as the immunogenPurity:Min. 95%FGFR2 antibody
FGFR2 antibody was raised in rabbit using the C terminal of FGFR2 as the immunogenPurity:Min. 95%Mtch1 antibody
Mtch1 antibody was raised in rabbit using the middle region of Mtch1 as the immunogenPurity:Min. 95%CLEC6A antibody
CLEC6A antibody was raised using the N terminal of CLEC6A corresponding to a region with amino acids FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKPurity:Min. 95%MIP3 antibody
MIP3 antibody was raised in rabbit using highly pure recombinant human MIP-3 as the immunogen.Purity:Min. 95%GNAI2 antibody
GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAPurity:Min. 95%MCM9 antibody
MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNPurity:Min. 95%RDH10 antibody
RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
Purity:Min. 95%PDGF BB antibody
PDGF BB antibody was raised in rabbit using highly pure recombinant human PDGF-BB as the immunogen.Purity:Min. 95%IL13RA2 antibody
IL13RA2 antibody was raised using the middle region of IL13RA2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPPPurity:Min. 95%PRKCI antibody
PRKCI antibody was raised in rabbit using the middle region of PRKCI as the immunogenPurity:Min. 95%Chymotrypsin-Like antibody
Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSPurity:Min. 95%SLC5A9 antibody
SLC5A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIAPurity:Min. 95%Annexin A4 antibody
Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLPurity:Min. 95%RAB18 antibody
RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGPurity:Min. 95%AWAT1 antibody
AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids LLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCPurity:Min. 95%BRF2 antibody
BRF2 antibody was raised in rabbit using the N terminal of BRF2 as the immunogenPurity:Min. 95%TMCC3 antibody
TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNLPurity:Min. 95%TBCB antibody
TBCB antibody was raised in rabbit using the N terminal of Tbcb as the immunogenPurity:Min. 95%PRKAA1 antibody
PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH
Purity:Min. 95%RAB37 antibody
RAB37 antibody was raised in rabbit using the middle region of RAB37 as the immunogen
Purity:Min. 95%SCUBE2 antibody
SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGGPurity:Min. 95%RIOK3 antibody
RIOK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLA
Purity:Min. 95%GOSR1 antibody
GOSR1 antibody was raised in rabbit using the C terminal of GOSR1 as the immunogenPurity:Min. 95%ZBTB26 antibody
ZBTB26 antibody was raised in rabbit using the C terminal of ZBTB26 as the immunogenPurity:Min. 95%RAB26 antibody
RAB26 antibody was raised using the N terminal of RAB26 corresponding to a region with amino acids SRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPPurity:Min. 95%GPSN2 antibody
GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLRPurity:Min. 95%LMF2 antibody
LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGSPurity:Min. 95%ATP1B1 antibody
ATP1B1 antibody was raised using the middle region of ATP1B1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLPurity:Min. 95%DDAH1 antibody
DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTPurity:Min. 95%CYTB antibody
CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
Purity:Min. 95%TMEM16C antibody
TMEM16C antibody was raised using the middle region of TMEM16C corresponding to a region with amino acids WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIFPurity:Min. 95%CRMP1 antibody
CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIPurity:Min. 95%RPSA antibody
RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYPurity:Min. 95%Phkg1 antibody
Phkg1 antibody was raised in rabbit using the N terminal of Phkg1 as the immunogenPurity:Min. 95%PTOV1 antibody
PTOV1 antibody was raised in rabbit using the N terminal of PTOV1 as the immunogenPurity:Min. 95%Omp antibody
Omp antibody was raised in rabbit using the C terminal of Omp as the immunogen
Purity:Min. 95%C1D antibody
C1D antibody was raised in rabbit using the N terminal of C1D as the immunogenPurity:Min. 95%Ccl11 antibody
Ccl11 antibody was raised in rabbit using the C terminal of Ccl11 as the immunogenPurity:Min. 95%Fto antibody
Fto antibody was raised in rabbit using the N terminal of Fto as the immunogenPurity:Min. 95%M96 antibody
M96 antibody was raised in rabbit using the middle region of M96 as the immunogenPurity:Min. 95%ACBD5 antibody
ACBD5 antibody was raised using the N terminal of ACBD5 corresponding to a region with amino acids ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKPurity:Min. 95%OPA3 antibody
OPA3 antibody was raised in rabbit using the C terminal of OPA3 as the immunogenPurity:Min. 95%METT10D antibody
METT10D antibody was raised in rabbit using the N terminal of METT10D as the immunogenPurity:Min. 95%MIP1 γ antibody
MIP1 gamma antibody was raised in rabbit using highly pure recombinant murine MIP-1gamma as the immunogen.Purity:Min. 95%KLHL8 antibody
KLHL8 antibody was raised in rabbit using the N terminal of KLHL8 as the immunogenPurity:Min. 95%C7ORF42 antibody
C7ORF42 antibody was raised using the N terminal Of C7Orf42 corresponding to a region with amino acids FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM
Purity:Min. 95%INHBA antibody
INHBA antibody was raised in rabbit using the N terminal of INHBA as the immunogenPurity:Min. 95%CDH8 antibody
CDH8 antibody was raised using the middle region of CDH8 corresponding to a region with amino acids HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITLPurity:Min. 95%RGS19 antibody
RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWPurity:Min. 95%HSL antibody
The HSL antibody is a highly specialized monoclonal antibody that targets and interacts with nuclear proteins involved in various cellular processes. It is commonly used in life sciences research, particularly in studies related to hybridization and the identification of inhibitors. Additionally, the HSL antibody has been found to be effective against specific markers such as CD33 and osteopontin. This versatile antibody can also be utilized for its cytotoxic properties, making it a valuable tool in cancer research. With its ability to recognize and bind to activated proteins like oncostatin, taxol, and β-catenin, the HSL antibody offers researchers a powerful means of studying cellular pathways and mechanisms.
Purity:Min. 95%ZNF409 antibody
ZNF409 antibody was raised in rabbit using the middle region of ZNF409 as the immunogen
Purity:Min. 95%ZMYND17 antibody
ZMYND17 antibody was raised in rabbit using the C terminal of ZMYND17 as the immunogen
Purity:Min. 95%POLE4 antibody
POLE4 antibody was raised in rabbit using the N terminal of POLE4 as the immunogenPurity:Min. 95%DGKA antibody
DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELPurity:Min. 95%Cited4 antibody
Cited4 antibody was raised in rabbit using the middle region of Cited4 as the immunogenPurity:Min. 95%Lgals4 antibody
Lgals4 antibody was raised in rabbit using the C terminal of Lgals4 as the immunogenPurity:Min. 95%DHCR24 antibody
DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSKPurity:Min. 95%PRSS35 antibody
PRSS35 antibody was raised using the N terminal of PRSS35 corresponding to a region with amino acids PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG
Purity:Min. 95%SLC9A8 antibody
SLC9A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
Purity:Min. 95%RBBP4 antibody
RBBP4 antibody was raised using the N terminal of RBBP4 corresponding to a region with amino acids HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKPurity:Min. 95%LZTS2 antibody
LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHLPurity:Min. 95%PNN antibody
PNN antibody was raised using the middle region of PNN corresponding to a region with amino acids RRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRPurity:Min. 95%PIGA antibody
PIGA antibody was raised in rabbit using the middle region of PIGA as the immunogenPurity:Min. 95%PON3 antibody
PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF
Purity:Min. 95%ZNF785 antibody
ZNF785 antibody was raised in rabbit using the C terminal of ZNF785 as the immunogenPurity:Min. 95%UBL4A antibody
UBL4A antibody was raised in rabbit using the C terminal of UBL4A as the immunogenPurity:Min. 95%HSD3B1 antibody
HSD3B1 antibody was raised using the N terminal of HSD3B1 corresponding to a region with amino acids TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQPurity:Min. 95%RANTES antibody
RANTES antibody was raised in rabbit using highly pure recombinant murine RANTES as the immunogen.Purity:Min. 95%CNPase antibody
CNPase antibody was raised in rabbit using residues 68-84 [RVIVDKYRDGTKMVSAD] of the 46-48 kDa human CNPase protein as the immunogen.Purity:Min. 95%HAPLN1 antibody
HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLPurity:Min. 95%CNTF antibody
CNTF antibody was raised in rabbit using highly pure recombinant human CNTF as the immunogen.Purity:Min. 95%
