Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SERPINB2 antibody
The SERPINB2 antibody is a monoclonal antibody that is used in mass spectrometric methods to detect and study inhibitors of serine proteases. It specifically targets SERPINB2, a protein complex involved in regulating the activity of serine proteases. This antibody can be used in various life sciences research applications, including the study of nuclear extracts and the detection of autoantibodies. Additionally, it has been shown to inhibit the growth factor signaling pathway and act as a kinase inhibitor. The SERPINB2 antibody is a valuable tool for researchers in the field of protein analysis and characterization.BAFF antibody
BAFF antibody was raised in mouse using highly pure recombinant human BAFF as the immunogen.Borrelia burgdorferi Ab
Borrelia burgdorferi Ab is an amide that acts as a chemokine in the human body. It has been extensively studied in Life Sciences for its role in various processes. This compound has shown to be nephrotoxic and can be detected in human serum using Monoclonal Antibodies. Borrelia burgdorferi Ab has also been associated with the production of autoantibodies and the regulation of TGF-beta. Furthermore, it has shown cytotoxic effects on certain cells and has been studied for its potential therapeutic applications. The use of monoclonal antibodies targeting Borrelia burgdorferi Ab has shown promising results in research studies, indicating its potential as a diagnostic tool or therapeutic agent.RSV Antibody
The RSV Antibody is a highly effective antiviral treatment that utilizes monoclonal antibodies to combat respiratory syncytial virus (RSV) infections. These antibodies specifically target and neutralize the virus, preventing it from infecting healthy cells and spreading throughout the body.MDM4 antibody
The MDM4 antibody is a highly specialized monoclonal antibody that targets the growth factor MDM4. This antibody has been shown to be effective in inhibiting the activity of MDM4, which plays a crucial role in adipose tissue development. By binding to MDM4, the antibody prevents its activation and subsequent signaling pathways involved in adipogenesis. Additionally, this monoclonal antibody has been found to interact with histidine residues on MDM4, further enhancing its neutralizing effect.
RAB3IL1 antibody
RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHDDX1 antibody
DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGADAPP1 antibody
DAPP1 antibody was raised using the middle region of DAPP1 corresponding to a region with amino acids KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDEzrin antibody
The Ezrin antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of Ezrin protein. This antibody has been extensively studied in various research fields, including Life Sciences and Antibodies. It has shown remarkable efficacy in inhibiting the interaction between Ezrin and its binding partners, such as fibrinogen, leading to the disruption of important cellular processes.CKMB Antibody
CKMB Antibody is a monoclonal antibody that specifically targets creatine kinase MB (CK-MB), an enzyme found in the heart muscle. This antibody is widely used in the field of Life Sciences for various applications, including research and diagnostic purposes. CKMB Antibody has high affinity and specificity towards CK-MB, making it an ideal tool for detecting and quantifying CK-MB levels in biological samples. It can be used in immunoassays such as ELISA or Western blotting to accurately measure CK-MB concentrations. Additionally, this antibody has been utilized in the development of ophthalmic formulations and has shown potential therapeutic applications in targeting chemokines and tumor necrosis factor-alpha (TNF-α). With its exceptional binding properties and versatility, CKMB Antibody plays a crucial role in advancing scientific understanding of biomolecules and their interactions, paving the way for innovative research breakthroughs in the field of Life Sciences.Thrombin antibody (HRP)
Thrombin antibody (HRP) was raised in sheep using Thrombin prepared from purified rabbit Prothrombin as the immunogen.CX36 antibody
CX36 antibody was raised using the middle region of Cx36 corresponding to a region with amino acids NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNALKB1 antibody
The LKB1 antibody is a monoclonal antibody that plays a crucial role in inhibiting the growth factor signaling pathway. It is water-soluble and specifically targets enteroendocrine cells, which are responsible for regulating glucose homeostasis and insulin secretion. This antibody has shown promising results in reducing amyloid plaque formation in Alzheimer's disease models, making it a potential therapeutic option for treating this neurodegenerative disorder. Additionally, the LKB1 antibody has cytotoxic effects on cancer cells by inhibiting endothelial cell growth and disrupting tumor angiogenesis. It can be used as a research tool in various life sciences studies, including investigating dopamine signaling pathways and assessing microvessel density. With its neutralizing properties, this mouse monoclonal antibody is highly valuable for both basic research and potential therapeutic applications.
RAD17 antibody
The RAD17 antibody is a highly specialized inhibitor used in Life Sciences research. It targets the RAD17 protein, which plays a crucial role in DNA repair and cell cycle regulation. This antibody is commonly used in assays to study the function of RAD17 and its interactions with other proteins involved in DNA damage response pathways. The RAD17 antibody is a polyclonal antibody, meaning it is produced by multiple clones of B cells and can recognize different epitopes on the target protein. Its high specificity makes it an ideal tool for studying the effects of RAD17 inhibition on various cellular processes. Researchers also use this antibody to investigate the potential therapeutic applications of targeting RAD17 in diseases such as cancer. With its exceptional binding affinity and selectivity, the RAD17 antibody offers valuable insights into the intricate mechanisms underlying DNA repair and genome stability.RP2 antibody
RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGFilaria Antibody
Filaria Antibody is a highly effective and specialized medication that targets specific antibodies, including anti-cd25 antibody drugs. It falls under the category of histone deacetylase inhibitors and is known for its potent amide and heteroaromatic properties. Developed for use in the field of Life Sciences, this monoclonal antibody has been extensively tested and proven to be highly activated against filaria infections.STAU1 antibody
STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG
TTF1 antibody
The TTF1 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It is designed to target and bind to the thyroid transcription factor 1 (TTF1), which plays a crucial role in regulating the expression of genes involved in cholinergic signaling and glycan synthesis. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.PYCR2 antibody
PYCR2 antibody was raised using the middle region of PYCR2 corresponding to a region with amino acids LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRECOL1A2 antibody
The COL1A2 antibody is a powerful tool used in Life Sciences research. It specifically targets collagen, a crucial component of connective tissues, and can be used to investigate various cellular processes. This antibody has been shown to neutralize the effects of dopamine, TGF-beta1, and interferon, making it an essential tool for studying their roles in different biological systems. Additionally, the COL1A2 antibody has been used to successfully detect and measure the levels of activated polymerase enzyme and TGF-beta growth factor in samples. It is available as a polyclonal antibody and has also been used in studies involving phosphatase and glutamate. With its high specificity and reliability, the COL1A2 antibody is an invaluable asset for researchers aiming to unravel the intricacies of collagen-related processes.GALM antibody
GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKOSBPL1A antibody
OSBPL1A antibody was raised using the middle region of OSBPL1A corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSIInvolucrin antibody
The Involucrin antibody is a highly specialized monoclonal antibody that targets the biomolecule involucrin. It is commonly used in Life Sciences research to study the role of involucrin in various biological processes. Involucrin is a glycoprotein that plays a crucial role in the formation and maintenance of the skin barrier. This antibody specifically binds to involucrin, allowing researchers to study its function and localization within cells.LYPD5 antibody
LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPp27 Kip1 antibody
The p27 Kip1 antibody is a highly specialized antibody that is used in various research applications in the field of Life Sciences. It is an autoantibody that specifically targets the p27 Kip1 protein, which plays a crucial role in regulating cell cycle progression and cell proliferation. This antibody is colloidal in nature, allowing for easy and efficient detection of the p27 Kip1 protein in biological samples.RORA antibody
RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCRBP4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. It works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high efficacy through patch-clamp techniques on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.E2F1 antibody
The E2F1 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. It is an essential component of the cell cycle regulation and is involved in the transcriptional activation of genes required for DNA replication and cell division. This monoclonal antibody specifically targets E2F1, allowing for precise detection and analysis of its expression levels.Galectin 9 antibody
Galectin 9 antibody is a glycoprotein that belongs to the class of polyclonal antibodies. It is highly reactive and activated in various life science applications. This antibody acts as a growth factor and exhibits antiviral properties by binding to specific proteins. Galectin 9 antibody has been shown to have neutralizing and cytotoxic effects on HL-60 cells, making it a potent tool for research purposes. Its multidrug resistance capabilities make it an ideal candidate for developing therapeutic antibodies. With its high specificity and functionality, this monoclonal antibody is a valuable asset in the field of biotechnology and immunology.Troponin I Type 3 antibody
Troponin I Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI
BXDC5 antibody
BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDSAMHD1 antibody
The SAMHD1 antibody is a highly effective monoclonal antibody that targets and neutralizes the SAMHD1 protein. This antibody has been shown to induce lysis of cells expressing high levels of SAMHD1, making it an essential tool for research in the field of Life Sciences. Additionally, the SAMHD1 antibody has demonstrated its efficacy in blocking the activity of vasoactive intestinal peptide (VIP), a potent vasodilator. This makes it a valuable tool for studying the role of VIP in various physiological processes. Furthermore, this antibody can be used in combination with chimeric receptors to enhance the cytotoxic effects of targeted therapies. With its wide range of applications and exceptional specificity, the SAMHD1 antibody is an invaluable asset for researchers in need of reliable tools for their studies.Annexin A13 antibody
Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSDDX19A antibody
DDX19A antibody was raised using a synthetic peptide corresponding to a region with amino acids IKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNClaudin 15 antibody
Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
KI67 antibody
KI67 antibody was raised in Mouse using synthetic peptide corresponding to aa (CEDLAGFKELFQTPG) of human KI67, conjugated to KLH as the immunogen.Borrelia burgdorferi antibody (biotin)
Borrelia burgdorferi antibody (biotin) was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.Ret antibody
The Ret antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets the Ret protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of Ret.
EIF4A1 antibody
EIF4A1 antibody was raised using the middle region of EIF4A1 corresponding to a region with amino acids TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCABHD5 antibody
ABHD5 antibody was raised using the C terminal of ABHD5 corresponding to a region with amino acids SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK
SF3A1 antibody
SF3A1 antibody was raised using the N terminal of SF3A1 corresponding to a region with amino acids RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQKCNH6 antibody
KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICGPCFSSSynaptophysin antibody
The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.
CHAT antibody
The CHAT antibody is a polyclonal antibody that specifically targets the choline acetyltransferase (CHAT) enzyme. CHAT is responsible for the synthesis of acetylcholine, a neurotransmitter involved in cholinergic signaling. This antibody is widely used in life sciences research to study the role of cholinergic signaling in various biological processes.Keratin K8 antibody
Keratin K8 antibody was raised in Mouse using a purified recombinant fragment of human Cytokeratin (aa391-483) expressed in E. coli as the immunogen.KHDRBS2 antibody
KHDRBS2 antibody was raised using the middle region of KHDRBS2 corresponding to a region with amino acids EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGAstrovirus antibody
Astrovirus antibody was raised in mouse using group antigen of astrovirus as the immunogen.C10ORF56 antibody
C10ORF56 antibody was raised using the middle region of C10Orf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL
EXOSC3 antibody
EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK
