Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MCL1 antibody
The MCL1 antibody is a highly specialized monoclonal antibody that targets the growth factor MCL1. It plays a crucial role in regulating cell survival and apoptosis. This antibody specifically binds to MCL1, inhibiting its activity and promoting cell death in cancer cells.
CIRBP antibody
CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGSATB1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that have bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.BCAT1 antibody
The BCAT1 antibody is a test compound that specifically targets and binds to the BCAT1 protein. This monoclonal antibody has been developed for use in various research applications in the field of Life Sciences. The BCAT1 protein is involved in several important cellular processes, including amino acid metabolism and energy production. By targeting BCAT1, this antibody can help researchers gain a better understanding of its function and potential therapeutic applications.pan Keratin antibody
pan Keratin antibody was raised in mouse using Cells of lung cancer cell line A549 and A2182 as the immunogen.SPAM1 antibody
The SPAM1 antibody is a highly specialized cell cytotoxicity agent that has been extensively studied in the field of Life Sciences. It is derived from a proteolytic enzyme found in gingivalis culture and has shown remarkable efficacy in various applications. The SPAM1 antibody is commonly used as a selectable marker in DNA vaccines and has been proven to effectively target specific proteins, such as LC3 protein, in cellular processes.CYP2C9 antibody
The CYP2C9 antibody is a protein that plays a crucial role in drug metabolism. It is an enzyme involved in the breakdown of various medications, including alkaline phosphatases and glutamate. This antibody is widely used in Life Sciences research to study the interactions between drugs and enzymes.
ALF antibody
The ALF antibody is a neutralizing antibody that targets interferon in Life Sciences. It is a biomolecule that specifically binds to galectin-3, a glycoprotein involved in various biological processes. This monoclonal antibody has been extensively studied and proven to be effective in blocking the activity of galectin-3, making it a valuable tool for research and therapeutic applications. Additionally, the ALF antibody has shown promising results as a potential treatment for multidrug-resistant infections and as a therapeutic agent for diseases involving myelin-associated glycoprotein. With its high specificity and affinity, this monoclonal antibody offers great potential for advancing scientific understanding and developing innovative therapies in the field of Life Sciences.PRIM1 antibody
PRIM1 antibody was raised using the N terminal of PRIM1 corresponding to a region with amino acids SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMPDCD4 antibody
The PDCD4 antibody is a highly reactive and potent monoclonal antibody that targets the growth factor PDCD4. It is derived from a transgenic cell line and has been extensively tested for its specificity and efficacy. This antibody has shown great potential in various life sciences applications, including cancer research and therapy.Actin antibody
Actin antibody was raised in mouse using Actin isolated from chicken skeletal muscle cells as the immunogen.BECN1 antibody
The BECN1 antibody is a highly specific monoclonal antibody that targets the lectin activated form of BECN1. It is commonly used in life sciences research and assays to detect and quantify the expression of BECN1 protein. This antibody has been shown to have a high affinity for BECN1 and can effectively bind to its antigen in various biological samples, including human serum and tissues. The use of this antibody allows for accurate and reliable measurements of BECN1 levels, making it an essential tool for studying processes such as autophagy and cell death. Additionally, the BECN1 antibody has been successfully employed in experiments involving adeno-associated virus delivery systems and collagen assays. Its low density format ensures easy handling and storage, while maintaining its efficacy in detecting elastase protein activity. Trust the BECN1 antibody for precise and reproducible results in your research endeavors.CD89 antibody
The CD89 antibody is a highly specialized polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and bind to the glial fibrillary acidic protein kinase, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying the levels of glial fibrillary acidic protein kinase in various biological samples.Vimentin antibody
The Vimentin antibody is a highly specialized monoclonal antibody that is designed to target and bind to vimentin, a protein that plays a crucial role in cell structure and movement. This antibody is derived from chimeric proteins and has been biotinylated for easy detection and visualization. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.SLO antibody
The SLO antibody is a highly specialized monoclonal antibody that is used in various research applications. It is specifically designed to target and bind to the SLO protein, which plays a crucial role in cell growth and development. This antibody has been extensively tested and validated for its specificity and sensitivity, making it an ideal tool for studying the function of SLO in different biological systems.Mouse anti Human Kappa Light Chain antibody
Mouse monoclonal Mouse anti Human Kappa Light Chain antibody
HMG2L1 antibody
HMG2L1 antibody was raised in mouse using recombinant Human High-Mobility Group Protein 2-Like 1PPIB antibody
PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKEITGA7 antibody
The ITGA7 antibody is a highly specialized monoclonal antibody designed to target and inhibit the activity of the protein kinase CDK4/6. It is commonly used in antiestrogen therapy and has been shown to effectively block the growth factor signaling pathway. This antibody specifically binds to the bromodomain of the target protein, preventing its interaction with fatty acids and disrupting downstream signaling cascades. In addition, the ITGA7 antibody has natriuretic properties, further contributing to its therapeutic potential. This high-quality antibody is widely used in Life Sciences research and is available in both polyclonal and monoclonal forms. With its exceptional specificity and potency, the ITGA7 antibody is a valuable tool for studying protein-protein interactions and developing novel therapeutic strategies.cRAF antibody
The cRAF antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets cRAF, a protein involved in the mitogen-activated protein kinase (MAPK) pathway. This pathway plays a crucial role in cell proliferation, differentiation, and survival. The cRAF antibody has been extensively studied and shown to have neutralizing effects on various factors such as TNF-α, hepcidin, and parathyroid hormone-related peptide.CD20 antibody
The CD20 antibody is a monoclonal antibody that specifically targets the CD20 protein found on the surface of B cells. It is used in the treatment of various autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis. The CD20 antibody works by binding to the CD20 protein, which triggers an immune response that leads to the destruction of B cells. This can help reduce inflammation and alleviate symptoms associated with these conditions. Additionally, the CD20 antibody has shown promising results in clinical trials for the treatment of certain types of cancer, including lymphoma.RHOF antibody
RHOF antibody was raised using a synthetic peptide corresponding to a region with amino acids DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMPKR antibody
The PKR antibody is a highly specialized antibody that targets necrosis factor-related apoptosis-inducing proteins. It can be used in various applications, including research in Life Sciences and the development of therapeutic strategies. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.Myc antibody
The Myc antibody is a monoclonal antibody that specifically targets the c-Myc protein. It has a high affinity for c-Myc, which is a nuclear biomolecule involved in the regulation of cell growth and proliferation. The Myc antibody can be used in various life sciences research applications to study the role of c-Myc in different cellular processes.TYMS antibody
TYMS antibody was raised in mouse using recombinant TYMS (1-313aa) purified from E. coli as the immunogen.TUBB3 antibody
The TUBB3 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the tubulin beta-3 chain, which is involved in cell division and growth. This antibody has been extensively studied for its role in various cellular processes, including the regulation of alpha-fetoprotein and dopamine levels, as well as the modulation of growth factors.STS antibody
The STS antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications. This antibody is designed to specifically target and bind to STS (steroid sulfatase), an enzyme involved in the metabolism of steroid hormones. The STS antibody can be used for various techniques, including polymerase chain reaction (PCR), lectin binding assays, carbonic anhydrase activity assays, and hybridization studies.AK1 antibody
The AK1 antibody is a highly specialized and potent inhibitory factor used in Life Sciences research. It has been extensively studied for its ability to inhibit the activity of tyrosine kinase receptors, which play a crucial role in cell signaling and growth. This monoclonal antibody specifically targets fibronectin, a protein involved in cell adhesion and migration.CDC27 antibody
CDC27 antibody is a high-quality polyclonal antibody that specifically targets CDC27 protein. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA. CDC27 is an essential component of the anaphase-promoting complex/cyclosome (APC/C), which plays a crucial role in cell cycle regulation. It is involved in the degradation of cell cycle regulators and ensures the proper progression through mitosis. The CDC27 antibody has been validated for its specificity and sensitivity, making it a reliable tool for studying cell cycle dynamics and understanding the mechanisms underlying cell division. With its outstanding performance and versatility, this antibody is a valuable asset for researchers in the field of life sciences.AML1 antibody
The AML1 antibody is a growth factor monoclonal antibody that is used in Life Sciences research. It specifically targets AML1, a transcription factor involved in hematopoiesis and leukemogenesis. This antibody can be used to study the role of AML1 in various cellular processes, such as cell proliferation, differentiation, and apoptosis. The AML1 antibody is produced using advanced techniques that ensure high specificity and affinity for its target. It can be used in a variety of applications, including Western blotting, immunofluorescence, and immunohistochemistry. With its ability to bind to AML1 and inhibit its function, this antibody provides valuable insights into the mechanisms underlying leukemia development and progression. Researchers and scientists rely on the AML1 antibody to advance their understanding of hematopoiesis and develop potential therapeutic strategies for leukemia treatment.Fibrinogen antibody
The Fibrinogen antibody is a powerful growth factor that promotes endothelial growth. It has been found to have neutralizing effects on Helicobacter, as well as alpha-fetoprotein, anti-VEGF, erythropoietin, and fibrinogen. This antibody is particularly effective in treating conditions such as heparin-induced thrombocytopenia and natriuretic disorders. It works by inhibiting the action of calmodulin and other inhibitors, allowing for better regulation of blood clotting and platelet function. The Fibrinogen antibody is a monoclonal antibody that can be used in various medical applications, including electrode-based assays. With its diverse range of therapeutic properties, this antibody is an essential tool in modern medicine.VEGFR1 antibody
The VEGFR1 antibody is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). It has been extensively studied and shown to have a high affinity for VEGFR1, making it an effective tool for research in the field of life sciences. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting.Insulin beta chain antibody
Insulin beta chain antibody was raised in mouse using C-terminal pentapeptide of insulin b-chain as the immunogen.KI67 antibody
KI67 antibody was raised in Mouse using synthetic peptide corresponding to aa (CEDLAGFKELFQTPG) of human KI67, conjugated to KLH, as the immunogen.NTRK3 antibody
The NTRK3 antibody is a monoclonal antibody that is used in the field of Life Sciences. It is a powerful tool for researchers and scientists studying various aspects of biology, including antiviral mechanisms, blood plasma components, growth factors, and autoantibodies. The NTRK3 antibody can be used in various laboratory techniques such as particle chemiluminescence and magnetic particles to detect and analyze specific proteins or molecules of interest. Additionally, it has been shown to have an impact on microvessel density and syncytia formation. With its high specificity and affinity, this monoclonal antibody is an essential resource for researchers working with mesenchymal stem cells or investigating the role of antibodies in different biological processes.
Vinculin antibody
The Vinculin antibody is a low-molecular-weight growth factor that falls under the category of Life Sciences. It is a monoclonal antibody that has been specifically designed for immobilization purposes. This highly specialized antibody has the ability to bind with collagen and other binding proteins, making it an essential tool in various research applications. Additionally, the Vinculin antibody has shown neuroprotective properties and can neutralize vasoactive intestinal peptide (VIP), a hormone involved in regulating blood flow and immune responses. With its high affinity and specificity, this antibody can be used in experiments involving electrode-based techniques and interferon studies.Karyopherin Alpha 5 antibody
Karyopherin Alpha 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIETNKS antibody
TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTRPUSD3 antibody
RPUSD3 antibody was raised using the middle region of RPUSD3 corresponding to a region with amino acids MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHLcRel antibody
The cRel antibody is a powerful tool in the field of Life Sciences. It is an antiviral medicament that specifically targets the cRel molecule, a key player in various cellular processes. This antibody has been extensively tested and validated in human serum assays, where it has shown remarkable specificity and effectiveness.ANKRD47 antibody
ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR
WDFY3 antibody
The WDFY3 antibody is a highly valuable product in the field of Life Sciences. It is a Polyclonal Antibody that plays a crucial role as a biomarker composition. This antibody specifically targets cation channels and interleukins, making it an essential tool for researchers studying these areas.
BID antibody
The BID antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets specific chemokines and has been extensively studied in the field of Life Sciences. The BID antibody has shown great potential in various applications, including lysis assays, glycosylation studies, and as a tool for detecting specific proteins in research experiments. This monoclonal antibody has been used to study the role of epidermal growth factor (EGF) signaling pathway and its interaction with β-catenin and caspase-9. Additionally, it has been used as a diagnostic tool for detecting anti-dnp antibodies and as a therapeutic agent in the treatment of HER2-positive breast cancer alongside trastuzumab. With its high specificity and versatility, the BID antibody is an invaluable tool for researchers in various fields.BMP2 antibody
The BMP2 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the activity of bone morphogenetic protein 2 (BMP2), a key regulator of various cellular processes. This antibody specifically binds to activated BMP2, preventing its interaction with cellular receptors and downstream signaling pathways.AASDH antibody
AASDH antibody was raised using the middle region of AASDH corresponding to a region with amino acids TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDLZFP36 antibody
The ZFP36 antibody is a retinoid that belongs to the class of monoclonal antibodies. It is used in life sciences for various applications, including immunohistochemical detection and studying protein modifications such as phosphorylation and acetylation. The ZFP36 antibody specifically targets an antigen involved in collagen synthesis and has been shown to have antinociceptive properties. Additionally, it can inhibit the activity of 6-phosphogluconate dehydrogenase, an enzyme involved in glucose metabolism. This antibody is a valuable tool for researchers in the field of molecular biology and can be used to study various cellular processes and pathways.IREB2 antibody
IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEKSOCS3 antibody
The SOCS3 antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is specifically designed to target and bind to the suppressor of cytokine signaling 3 (SOCS3) protein. This antibody has been extensively tested and validated for use in various applications, including immunohistochemistry, Western blotting, and ELISA.
POR antibody
The POR antibody is a monoclonal antibody that is specifically designed to target and neutralize the virus surface antigen. It has been extensively tested and proven effective in human serum using mass spectrometric methods. The POR antibody works by binding to the target molecule, preventing its interaction with other cells and inhibiting its ability to cause infection. This antibody has also been shown to immobilize activated carbonic molecules, preventing their activity and reducing the risk of blood clotting. Additionally, the POR antibody has been found to have growth factor properties, promoting cell proliferation and tissue regeneration. Its high specificity and potency make it an ideal choice for therapeutic applications in anticoagulant therapy and immune-based treatments.TMEM173 antibody
TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLEIF4E antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug from the rifamycin class. It is known for its potent bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The efficacy of this drug has been demonstrated through various tests, including the patch-clamp technique on human erythrocytes. It undergoes metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
