Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SNAP23 antibody
The SNAP23 antibody is a highly specialized polyclonal antibody that targets the necrosis factor-related apoptosis-inducing protein complex. It is commonly used in the field of Life Sciences to study endothelial growth and other related processes. This antibody can also be used as a monoclonal antibody to neutralize specific proteins or growth factors in human serum. Additionally, it has been shown to have a high affinity for steroid receptors and can be used in various nuclear studies. With its advanced technology and specificity, the SNAP23 antibody is an essential tool for researchers in the field of Life Sciences.SYT1 antibody
The SYT1 antibody is a monoclonal antibody that specifically targets the Synaptotagmin-1 (SYT1) antigen. It is widely used in Life Sciences research for various applications, including the detection and analysis of SYT1 expression in cells and tissues. This antibody has been shown to have high specificity and sensitivity, making it a valuable tool for studying the role of SYT1 in synaptic transmission, neurotransmitter release, and other cellular processes.
CSTF2T antibody
CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVTCD34 antibody
The CD34 antibody is a growth factor that plays a crucial role in microvessel density. This antibody is buffered and colloidal, making it ideal for use in various applications within the Life Sciences field. It is classified as a monoclonal antibody, which means it specifically targets a biomolecule of interest. The CD34 antibody has neutralizing properties and can be used as an immunosuppressant in certain cases. Its effectiveness can be measured through techniques such as electrophoresis and immunoassays. Additionally, this monoclonal antibody has been shown to interact with calmodulin, further highlighting its versatility and potential applications.West Nile virus antibody
The West Nile virus antibody is a highly effective neutralizing agent that can be used for the detection and treatment of West Nile virus infections. It has been shown to bind to specific viral proteins, preventing the virus from entering host cells and replicating. This antibody is produced using advanced monoclonal antibody technology, ensuring high specificity and potency. In addition to its antiviral properties, this antibody has also been demonstrated to have other beneficial effects. It can activate various immune responses, such as chemokine production and fibrinogen activation, which are essential for controlling viral infections. Furthermore, it has been found to have potential therapeutic applications in the treatment of certain cancers, as it exhibits anti-mesothelin and alpha-fetoprotein activities. With its wide range of applications in both diagnostics and therapeutics, this West Nile virus antibody is an invaluable tool in the field of life sciences.CHST14 antibody
CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPCK1 antibody
PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEERHPN1 antibody
RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP
4EBP1 antibody
The 4EBP1 antibody is a polyclonal antibody that belongs to the class of drug antibodies. It is widely used in life sciences research as an inhibitor and neutralizing agent. This antibody specifically targets and binds to 4EBP1, a family of binding proteins involved in regulating protein synthesis. The 4EBP1 antibody can be used in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It is buffered and optimized for use in different experimental conditions. Whether you are studying interleukins, ranolazine, or other chimeric proteins, the 4EBP1 antibody is a valuable tool for detecting and analyzing activated proteins. With its high specificity and sensitivity, this monoclonal antibody ensures accurate and reliable results in your research experiments.CD90 antibody
The CD90 antibody is a monoclonal antibody that targets the sclerostin protein. It is used to neutralize the activity of sclerostin, which is a negative regulator of bone growth. By blocking sclerostin, the CD90 antibody promotes bone formation and can potentially be used in the treatment of conditions such as osteoporosis.PDZRN4 antibody
PDZRN4 antibody was raised using the N terminal of PDZRN4 corresponding to a region with amino acids SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKLCLPP antibody
The CLPP antibody is a monoclonal antibody that targets collagen, a crucial component in the growth and development of various tissues. This antibody has been extensively studied for its potential therapeutic applications in promoting the growth and differentiation of mesenchymal stem cells. It works by binding to specific receptors on the surface of these cells, triggering a series of signaling events that promote cell proliferation and tissue regeneration.LOX antibody
The LOX antibody is a reactive monoclonal antibody that is activated through chromatographic techniques. It is specifically designed to target and bind to LOX, a chemokine involved in various cellular processes. This antibody has been extensively used in research studies, such as Western blotting and immunohistochemistry, to detect the presence and localization of LOX in different tissues and cell types. Additionally, the LOX antibody has shown promising results in multidrug resistance studies, particularly in cardiomyocytes where it inhibits the efflux of anticancer drugs. Furthermore, this monoclonal antibody has demonstrated its potential therapeutic applications in regulating glucagon secretion and modulating polyunsaturated fatty acid metabolism. With its high specificity and affinity, the LOX antibody is an invaluable tool for researchers in the life sciences field.RAP1A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.C1S antibody
The C1S antibody is a potent monoclonal antibody that belongs to the class of neutralizing antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and neutralizes C1S, a protease involved in the complement system. By inhibiting C1S activity, this antibody can modulate immune responses and prevent excessive inflammation. Additionally, this monoclonal antibody has been shown to have mitogenic properties, stimulating cell growth and proliferation in various cell types such as dopamine-producing cells and collagen-producing cells. Furthermore, it has been used in research studies to enhance the oncolytic activity of adenoviruses and inhibit protease activity at low pH levels. The C1S antibody is a valuable tool for researchers studying hepatocyte growth and activation pathways.
FAM45B antibody
FAM45B antibody was raised using the middle region of FAM45B corresponding to a region with amino acids AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRAK5 antibody
AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYCD20 antibody
The CD20 antibody is a glycoprotein that belongs to the family of polyclonal antibodies. It is commonly used in Life Sciences for various applications, including research and diagnostics. The CD20 antibody specifically targets the CD20 antigen, which is expressed on the surface of certain cells, such as B-cells and some types of cancer cells.ZNF294 antibody
ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPANHEDC1 antibody
NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQTPOR antibody
The POR antibody is a monoclonal antibody that targets the growth factor POR (Peroxidase). This antibody is used for immobilization studies and can be activated by chemical agents. It specifically binds to the cation channel and glycoprotein POR, allowing for easy detection and analysis. The POR antibody has been extensively tested in Life Sciences research and has shown high specificity and sensitivity. It can be used in various applications such as Western blotting, ELISA, immunohistochemistry, and flow cytometry. Additionally, this monoclonal antibody has been proven effective in studying arginase and lipoprotein lipase. Trust the POR antibody for reliable results in your research experiments.RB antibody
The RB antibody is a highly specialized monoclonal antibody that has been developed for ultrasensitive detection in the field of Life Sciences. This antibody exhibits high affinity and specificity towards its target molecule, making it ideal for immunoassays and other research applications.SRY antibody
The SRY antibody is a biomolecule that specifically targets the sex-determining region Y (SRY) protein. It is commonly used in research involving mesenchymal stem cells and brain natriuretic peptide. This antibody is buffered to ensure stability and effectiveness in various experimental conditions. The SRY antibody is available as both polyclonal antibodies and monoclonal antibodies, providing researchers with different options depending on their specific needs. It can be used as a standalone reagent or as part of a conjugate compound for enhanced detection and analysis. With its cytotoxic and growth factor properties, the SRY antibody plays a crucial role in various life sciences applications.FOXB2 antibody
The FOXB2 antibody is a highly specialized antibody that targets specific proteins and markers in various biological processes. This antibody specifically binds to osteopontin, E-cadherin, amyloid plaque, oncostatin, glutamate, serum albumin protein, and β-catenin. It is widely used in the field of life sciences for research purposes.
SERPINA3 antibody
The SERPINA3 antibody is a monoclonal antibody that targets the SERPINA3 protein. This protein plays a crucial role in various biological processes, including the regulation of lipoprotein metabolism and mineralocorticoid receptor activity. The antibody specifically binds to the SERPINA3 protein, forming a protein complex that inhibits its function.ULBP2 antibody
The ULBP2 antibody is a monoclonal antibody that acts as a growth factor and anti-VEGF (vascular endothelial growth factor). It belongs to the family of natriuretic globulin antibodies, which are binding proteins that regulate blood pressure and fluid balance. This antibody specifically targets ULBP2, a protein that plays a role in immune response regulation. By binding to ULBP2, the antibody can modulate the activity of immune cells and influence various physiological processes. The ULBP2 antibody can also be used in research and diagnostic applications in the field of Life Sciences. With its high specificity and affinity, this polyclonal antibody is an essential tool for studying the functions of ULBP2 and its interaction with other molecules in different biological systems.FHL1 antibody
The FHL1 antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) and leukemia inhibitory factor (LIF). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
CDC6 antibody
The CDC6 antibody is a cytotoxic hormone peptide that has been shown to have inhibitory effects on antiphospholipid antibodies. It acts as an electrode for interferon and dopamine, and it also functions as a glycoprotein with anticoagulant and antiviral properties. This monoclonal antibody is specifically designed to target human serum autoantibodies, making it highly effective in treating various conditions related to autoimmune disorders. Additionally, the CDC6 antibody has been found to exhibit leukemia inhibitory factor activity, further enhancing its therapeutic potential.MIOX antibody
The MIOX antibody is a highly specialized monoclonal antibody that targets the tyrosine kinase receptor. It acts by inhibiting the activity of this receptor, which plays a crucial role in cell growth and division. By blocking the receptor, the MIOX antibody effectively prevents the activation of downstream signaling pathways that promote tumor growth.PUM2 antibody
PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWPEX26 antibody
PEX26 antibody was raised using the middle region of PEX26 corresponding to a region with amino acids ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKRBM42 antibody
RBM42 antibody was raised using the C terminal of RBM42 corresponding to a region with amino acids DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLRCENPA antibody
CENPA antibody was raised using the middle region of CENPA corresponding to a region with amino acids ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLGBRF1 antibody
BRF1 antibody was raised in mouse using recombinant Brf1 Homolog, Subunit Of Rna Polymerase Iii Transcription Initiation Factor Iiib (S. Cerevisiae) (Brf1)MOV10L1 antibody
MOV10L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLPYGL antibody
PYGL antibody is a polyclonal antibody that is highly reactive and immunogenic. It is designed to target and neutralize autoantibodies, antiviral antibodies, and other harmful substances in the body. PYGL antibody specifically recognizes adenine and circumsporozoite protein, allowing for precise detection and elimination of these targets. The colloidal nature of this antibody ensures a strong antigen-antibody reaction, leading to efficient binding and neutralization of harmful agents. Additionally, PYGL antibody has been shown to enhance the production of growth factors, interferons, and cytotoxic agents, further boosting the body's immune response against pathogens. This versatile antibody is an essential tool in Life Sciences research and diagnostics.Synaptophysin antibody
The Synaptophysin antibody is a highly specific monoclonal antibody that targets the carbonic anhydrase enzyme. It is activated in cholinergic neurons and has been widely used in Life Sciences research. This antibody has anticoagulant properties and can neutralize the activity of protein kinase 3-kinase, a growth factor involved in fibrinogen glycation. Its high specificity makes it an essential tool for studying the role of carbonic anhydrase in various biological processes.RPA2 antibody
The RPA2 antibody is a highly specific monoclonal antibody that targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications.ApoBEC1 antibody
ApoBEC1 antibody was raised using the N terminal of APOBEC1 corresponding to a region with amino acids TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW
CD19 antibody
The CD19 antibody is a monoclonal antibody that has neutralizing properties. It is used in immunoassays to detect the presence of specific antibodies in human serum. The CD19 antibody is immobilized on microspheres and can be used as a test substance to determine the presence or absence of certain antibodies. This antibody has been modified with colloidal acid to enhance its stability and improve its binding affinity. Additionally, the CD19 antibody has shown efficacy against Pseudomonas aeruginosa, a common pathogen associated with respiratory infections. Its glycosylation and acid residue modifications contribute to its high specificity and effectiveness in targeting autoantibodies.ACAA1 antibody
ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
HP antibody
The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.ME3 antibody
ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD
