Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
PRCC antibody
The PRCC antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the PRCC protein, which is involved in the development of certain cancers. This antibody can be used in various applications, such as immunohistochemistry and western blotting, to detect and quantify the expression of PRCC in tissue samples. The PRCC antibody is highly specific and binds to the amino group of the PRCC protein with high affinity. It can be conjugated with different labels, such as colloidal gold or fluorescent dyes, for visualization purposes. This antibody is commonly used in combination with other antibodies, such as anti-CD33 or anti-HER2 antibodies, to study biomolecules and their interactions. Its versatility and reliability make it an essential tool for researchers studying cancer biology and related fields.
HSP27 antibody
HSP27 antibody is a specialized antibody that targets the heat shock protein 27 (HSP27). HSP27 is a glycoprotein that plays a crucial role in cellular stress response and has been implicated in various diseases. This antibody specifically binds to HSP27, allowing for its detection and measurement in biological samples. It is commonly used in life sciences research to study the function and regulation of HSP27. The HSP27 antibody can be used in techniques such as immobilization, interferon assays, and Western blotting. Whether you need a monoclonal or polyclonal antibody, the HSP27 antibody provides a valuable tool for investigating the role of HSP27 in cellular processes and disease development.GRHPR antibody
GRHPR antibody was raised using the N terminal of GRHPR corresponding to a region with amino acids EPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDH
NTRK3 antibody
NTRK3 antibody was raised in Mouse using purified recombinant extracellular fragment of human NTRK3 (aa32-429) fused with hIgGFc tag expressed in HEK293 cells as the immunogen.
PIGA antibody
The PIGA antibody is a monoclonal antibody that has a stimulatory effect on erythropoietin production. It is used in the field of Life Sciences for research and diagnostic purposes. This antibody specifically targets PIGA, which is a glycoprotein involved in the biosynthesis of glycosylphosphatidylinositol (GPI) anchors. The PIGA antibody can be used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. It has been shown to have neutralizing and cytotoxic effects on cells expressing PIGA, making it a valuable tool for studying the function of this protein. Additionally, the PIGA antibody can be used in lectin affinity chromatography and electrophoresis experiments due to its ability to bind to specific carbohydrate residues.Calcitonin antibody
Calcitonin antibody is a growth factor that belongs to the class of monoclonal antibodies. It is a pegylated glycoprotein that specifically targets calcitonin, a hormone involved in regulating calcium levels in the body. This antibody binds to calcitonin and inhibits its activity, leading to decreased calcium levels. Calcitonin antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications. Additionally, this antibody has been used in combination with other therapeutic agents such as trastuzumab to enhance their efficacy. With its cytotoxic properties and ability to neutralize calcitonin activity, this monoclonal antibody holds great potential for further advancements in the field of medicine.14-3-3 eta antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside:
Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, the ultimate antituberculosis drug from the rifamycins class. This potent compound is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Its unique mechanism of action involves binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. With its high frequency of human activity demonstrated through patch-clamp technique on human erythrocytes, it is a reliable choice for treating tuberculosis. Additionally, this drug undergoes various metabolic transformations, ensuring optimal efficacy. Don't let tuberculosis hold you back - choose 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for a brighter future.KCTD17 antibody
KCTD17 antibody was raised using the middle region of KCTD17 corresponding to a region with amino acids YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEGRP94 antibody
The GRP94 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is primarily used for research purposes and has a wide range of applications. This antibody specifically targets and binds to GRP94, which is a member of the heat shock protein 90 (HSP90) family.
CCL2 antibody
The CCL2 antibody is a monoclonal antibody that is used in Life Sciences for its neutralizing properties. It specifically targets and binds to CCL2, which is a chemokine involved in inflammation and immune response. By binding to CCL2, this antibody inhibits its function and prevents the activation of certain immune cells. The CCL2 antibody has been shown to be effective in blocking the activity of interferon-inducible protein 10 (IP-10), which is an inflammatory mediator. This makes it a promising therapeutic option for various diseases where CCL2 plays a role, such as liver inflammation and autoimmune disorders.UGT1A1 antibody
UGT1A1 antibody was raised using the middle region of UGT1A1 corresponding to a region with amino acids ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHMet antibody
The Met antibody is a highly specialized monoclonal antibody that targets the endothelial growth factor. It is commonly used in Life Sciences research to study the role of growth factors in various biological processes. This monoclonal antibody has a high affinity for binding proteins and can effectively neutralize their activity. Additionally, it has been shown to inhibit the formation of protein complexes involved in steroid and growth factor signaling pathways. The Met antibody is also used as a tool in diagnostic assays to detect the presence of specific proteins, such as alpha-fetoprotein or anti-ACTH antibodies. Its versatility and specificity make it an invaluable asset in scientific research and medical applications related to hepatocyte growth and other cellular processes.
PRR15 antibody
PRR15 antibody was raised using the middle region of PRR15 corresponding to a region with amino acids GDKSGSSRRNLKISRSGRFKEKRKVRATLLPEAGRSPEEAGFPGDPHEDKZPBP2 antibody
ZPBP2 antibody was raised using the middle region of ZPBP2 corresponding to a region with amino acids VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYGEEA1 antibody
The EEA1 antibody is a biomolecule that plays a crucial role in the field of Life Sciences. It is an essential component in the study of interferon and interleukin-6, as it acts as an inhibitor for these molecules. The EEA1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody demonstrates neutralizing properties, making it highly effective in assays and experiments where protease activity needs to be inhibited. With its colloidal nature, the EEA1 antibody ensures accurate and reliable results. Researchers can rely on this antibody to enhance their understanding of complex biological processes and advance scientific knowledge in various fields.COL4A3 antibody
The COL4A3 antibody is a polyclonal antibody that specifically targets the rubisco molecule. Rubisco is an enzyme involved in photosynthesis and is found in plants and some bacteria. This antibody has been developed for use in life sciences research and has the ability to neutralize the activity of rubisco. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The COL4A3 antibody is a valuable tool for researchers studying the role of rubisco in plant biology, as well as those investigating potential therapeutic targets for diseases related to rubisco dysfunction. Additionally, this antibody may have potential applications in the development of new drugs or treatments targeting rubisco-related disorders.MUC16 antibody
The MUC16 antibody is a monoclonal antibody that targets the MUC16 protein. This protein, also known as CA125, is a tumor marker that is often elevated in ovarian cancer. The MUC16 antibody specifically binds to the MUC16 protein, inhibiting its interaction with other molecules and preventing tumor growth and progression.
Salmonella antibody (biotin)
Salmonella antibody (biotin) was raised in rabbit using a mixture of S. enteriditis, S. typhimurium and S. heidelburg as the immunogen.CKMT2 antibody
CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPASTEAP1 antibody
The STEAP1 antibody is a highly effective and activated agent that plays a crucial role in various biological processes. It specifically targets vitronectin, an extracellular matrix protein involved in cell adhesion and migration. The STEAP1 antibody has been extensively studied for its ability to neutralize the effects of autoantibodies, which can lead to autoimmune diseases.HOXB9 antibody
HOXB9 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to HOXB9, a protein involved in various biological processes such as collagen synthesis and glycosylation. By inhibiting the activity of HOXB9, this antibody can be used to study its function and impact on cellular processes.LHRH Antibody
LHRH Antibody is a monoclonal antibody that specifically targets luteinizing hormone-releasing hormone (LHRH). It has been shown to inhibit the activity of LHRH, which plays a crucial role in regulating reproductive functions. This antibody has interferon-like activity and can modulate the release of vasoactive intestinal peptide and colony-stimulating factors. Additionally, it has been demonstrated to enhance the production of interferon-gamma (IFN-gamma) in human serum. LHRH Antibody may also have potential therapeutic applications in the treatment of conditions such as prostate cancer and breast cancer, as it can interfere with the growth-promoting effects of LHRH on tumor cells.cTnT antibody
The cTnT antibody is a highly specialized collagen monoclonal antibody that targets phosphorylcholine, which is activated by inorganic particles. This medicament is particularly effective in the field of Life Sciences and has been widely used in research involving mesenchymal stem cells. The cTnT antibody is known for its exceptional ability to detect and bind to specific contaminants, making it an invaluable tool for quality control purposes. Additionally, this antibody exhibits cytotoxic properties against unwanted growth factors and glycoproteins, further enhancing its utility in various applications. With both Polyclonal Antibodies and monoclonal antibodies available, researchers have the flexibility to choose the most suitable option for their specific needs.PRR16 antibody
PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPLPCMTD1 antibody
PCMTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIYp53 antibody
The p53 antibody is a growth factor that belongs to the family of GM-CSF (granulocyte-macrophage colony-stimulating factor) antibodies. It can be used for various applications in life sciences research. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their experiments. The p53 antibody has been extensively studied and validated for its ability to neutralize the activity of p53 dimers, which play a crucial role in cell cycle regulation and tumor suppression. Additionally, this antibody can be used for immobilization on electrodes or as a tool for phosphatase assays. With its high specificity and cytotoxicity, the p53 antibody is an essential component in many research projects within the field of life sciences.
CACNB1 antibody
CACNB1 antibody was raised using the N terminal of CACNB1 corresponding to a region with amino acids EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS
C6orf154 antibody
C6orf154 antibody was raised using the N terminal of C6orf154 corresponding to a region with amino acids MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRFBXO33 antibody
FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
EDG6 antibody
The EDG6 antibody is a highly specialized inhibitor that targets serine protease activity. It has been extensively tested and proven to effectively neutralize the function of this enzyme. This polyclonal antibody is derived from human serum and can be used in various applications, including nuclear extracts and spectrometric analysis.
CD318 antibody
The CD318 antibody is a monoclonal antibody that is used in Life Sciences research. It is specifically designed to target and bind to the CD318 antigen, which is found on the surface of activated cells. This antibody can be used in various applications, such as flow cytometry, immunohistochemistry, and Western blotting.Vitronectin antibody
The Vitronectin antibody is a glycosylated protein that plays a crucial role in various biological processes. It has been shown to interact with alpha-fetoprotein, an inhibitory factor involved in embryonic development and tissue regeneration. Additionally, the Vitronectin antibody can bind to leukemia inhibitory factor (LIF), a phosphatase that regulates cell growth and differentiation. This antibody also has an affinity for androgen receptors, which are involved in the development and maintenance of male characteristics.RFPL3 antibody
RFPL3 antibody was raised using the middle region of RFPL3 corresponding to a region with amino acids DADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRVHL antibody
The VHL antibody is a multidrug monoclonal antibody that specifically targets molecules involved in endothelial growth. It is widely used in Life Sciences research to study the role of growth factors, chemokines, and other signaling molecules in various cellular processes. This antibody has been shown to effectively neutralize the activity of activated growth factors, leading to a decrease in cell proliferation and migration. Additionally, it has demonstrated cytotoxic effects on cancer cells through its ability to induce cell death via various mechanisms, including hybridization and cell cytotoxicity. The VHL antibody is an essential tool for researchers studying angiogenesis, tumor biology, and therapeutic development.
Doublecortin antibody
The Doublecortin antibody is a highly specialized antibody that is activated by plasmin activity. It is commonly used in Life Sciences research to study protein-protein interactions and proteolytic processes. This antibody specifically targets hepcidin, a peptide hormone involved in iron metabolism, and has been shown to have neuroprotective effects. Additionally, the Doublecortin antibody has been found to inhibit glutamate-induced cell cytotoxicity and fibrinogen binding. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the best option for their specific needs. With its high specificity and ability to target specific amino acid residues, the Doublecortin antibody is a valuable tool in various research applications.CD49b antibody (Azide Free)
CD49b antibody (Azide free) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.CCT6B antibody
CCT6B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
GFAP antibody
GFAP antibody was raised in mouse using intermediate filament cytoskeleton from cultured human glioma cells as the immunogen.NT5DC1 antibody
NT5DC1 antibody was raised using the N terminal of NT5DC1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTFJAB1 antibody
The JAB1 antibody is a highly specialized product in the field of Life Sciences. It is an anti-mesothelin antibody that specifically binds to mesothelin, a protein involved in cell growth and differentiation. This antibody has been extensively studied and shown to have neutralizing properties against mesothelin, making it a valuable tool for research purposes.
DDR2 antibody
DDR2 antibody was raised in Mouse using a purified recombinant fragment of human DDR2 expressed in E. coli as the immunogen.
