Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
SIGLEC9 antibody
The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.
ERK1 antibody
ERK1 antibody was raised in mouse using recombinant full length ERK1 protein as the immunogen.Hexokinase antibody
Hexokinase antibody was raised in mouse using recombinant human Hexokinase1 (1-917aa) purified from E. coli as the immunogen.ATP5A1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it is highly effective in treating tuberculosis infections. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.p90RSK antibody
The p90RSK antibody is a monoclonal antibody that is used in Life Sciences research. It is specifically designed to inhibit the activity of p90RSK, a family of serine/threonine kinases. This antibody has been shown to have therapeutic potential in various conditions, including thrombocytopenia and mesenchymal stem cell disorders. By targeting p90RSK, this antibody can modulate the growth factor signaling pathways and regulate cellular processes such as proliferation, differentiation, and apoptosis. Additionally, the p90RSK antibody has been found to interact with chemokines and interleukin-6, further highlighting its potential as a valuable tool in immunological research. With its high specificity and affinity for its target, this antibody offers researchers a reliable tool for studying the role of p90RSK in various biological processes.Agrin antibody
The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development
VCAM1 antibody
The VCAM1 antibody is a monoclonal antibody that specifically targets the VCAM1 protein. This protein plays a crucial role in various biological processes, including cell adhesion and migration. The VCAM1 antibody has been extensively studied in the field of life sciences and has shown promising results in research related to cancer, inflammation, and immune response.
Daxx antibody
The Daxx antibody is a highly specialized medicament used in Life Sciences. It is an antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody has been shown to inhibit the glycosylation process of EGF, preventing its activation and subsequent signaling pathways. Additionally, the Daxx antibody has a neutralizing effect on E-cadherin, which plays a crucial role in cell adhesion.PZP antibody
The PZP antibody is a monoclonal antibody that targets taxol and oncostatin, which are growth factors involved in various biological processes. This antibody specifically binds to the CD33 antigen, making it an effective tool for research and therapeutic applications. Monoclonal antibodies like the PZP antibody are widely used in the field of life sciences for their ability to selectively target and inhibit specific molecules or pathways. The PZP antibody can be used in hybridization experiments, as well as in the development of inhibitors or activators for CD33-related signaling pathways. It is a valuable tool for researchers studying annexin or collagen-related processes. Whether you're conducting basic research or developing new therapies, the PZP antibody is an essential component in your scientific toolkit.
DGCR8 antibody
DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRORC2 antibody
The ORC2 antibody is a powerful tool used in Life Sciences research. It specifically targets the antigen associated with serotonin, which plays a crucial role in various physiological processes. This antibody can be used as a serum marker to detect the presence of autoantibodies or as a molecular marker to study the expression and localization of ORC2 in cells and tissues.GPSM2 antibody
GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAMyoglobin antibody
The Myoglobin antibody is an activated monoclonal antibody that belongs to the category of Life Sciences products. It is specifically designed to target and bind to myoglobin, a protein found in human serum. This antibody is highly specific and exhibits strong binding affinity towards myoglobin, making it an effective tool for various applications in research and diagnostics.IGF1R antibody
The IGF1R antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the insulin-like growth factor 1 receptor (IGF1R) and has been shown to have cytotoxic effects on various types of cancer cells. This antibody can neutralize the activity of IGF1R, which is a key regulator of cell growth and proliferation. Additionally, it has been found to inhibit the expression of alpha-fetoprotein, a marker associated with liver cancer. The IGF1R antibody can also be used as an anti-connexin agent, blocking gap junction-mediated intercellular communication. In addition to its role in cancer research, this antibody has applications in studying adipose tissue development, endothelial growth factors, and nuclear signaling pathways.NOL6 antibody
NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR
KIF5A antibody
KIF5A antibody was raised using the middle region of KIF5A corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHMMP12 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Studies have shown its high efficacy on human erythrocytes using a patch-clamp technique.NOSIP antibody
NOSIP antibody was raised using the N terminal of NOSIP corresponding to a region with amino acids LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQFOXA1 antibody
FOXA1 antibody is a monoclonal antibody that specifically targets β-catenin, a protein involved in various cellular processes. This antibody acts as a family kinase inhibitor, blocking the activity of kinases that regulate β-catenin signaling. It is widely used in life sciences research to study the role of β-catenin in development, cancer, and other diseases.CYP19 antibody
The CYP19 antibody is a highly specialized antibody that targets the aromatase enzyme, also known as cytochrome P450 19A1. This enzyme plays a crucial role in the synthesis of estrogen, making it an important target in hormone-related diseases and conditions. The CYP19 antibody specifically binds to the aromatase enzyme, inhibiting its activity and preventing the conversion of androgens into estrogens. This can have significant therapeutic implications in the treatment of hormone-dependent cancers such as breast cancer. Additionally, the CYP19 antibody has been used in research settings to study the regulation of estrogen synthesis and its impact on various physiological processes. With its high specificity and affinity for the aromatase enzyme, the CYP19 antibody is a valuable tool for both clinical and scientific applications in the field of endocrinology and oncology.NRF2 antibody
The NRF2 antibody is a highly effective tool in the field of immunology and molecular biology. This antibody belongs to the class of polyclonal antibodies, which are produced by multiple B cell clones and have the ability to recognize different epitopes on the target protein. The NRF2 antibody specifically targets the nuclear factor erythroid 2-related factor 2 (NRF2), a transcription factor that plays a crucial role in cellular defense against oxidative stress.EFNB2 antibody
The EFNB2 antibody is a medicinal product that falls under the category of Life Sciences. It is an antibody that specifically targets and inhibits the activity of EFNB2 protein. This antibody is known as a polyclonal antibody, meaning it is derived from multiple sources and can recognize different epitopes on the target protein. The EFNB2 antibody has been extensively studied and proven to be effective in various research applications within the field of Life Sciences. Its high specificity and affinity make it a valuable tool for scientists and researchers working in this area. With its ability to selectively bind to EFNB2 protein, this antibody opens up new possibilities for understanding its role in biological processes and developing therapeutic interventions.F3 antibody
The F3 antibody is a potent cytotoxic and inhibitory factor used in Life Sciences. It targets various proteins and molecules such as tyrosinase, insulin, collagen, and fibronectin. This antibody has been extensively studied for its ability to neutralize autoantibodies and anti-ACTH antibodies. The F3 antibody is highly specific and can be used in a wide range of applications including research, diagnostics, and therapeutics. Its unique properties make it an essential tool for studying protein-protein interactions, cell signaling pathways, and immune responses. With its high affinity and specificity, the F3 antibody offers researchers unparalleled accuracy and reliability in their experiments.SLC25A45 antibody
SLC25A45 antibody is a glycoprotein that belongs to the chemokine binding protein family. It plays a crucial role in various biological processes, including interferon signaling and hepatocyte growth regulation. This antibody is widely used in Life Sciences research for its ability to specifically bind to SLC25A45 and facilitate the detection and analysis of this protein. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The SLC25A45 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. Its high specificity and cytotoxic properties make it an essential tool for studying the function and expression of SLC25A45 in different cellular contexts.
eNOS antibody
The eNOS antibody is a highly specialized antibody used in the field of Life Sciences. It has been extensively studied and proven to have significant cation binding properties. Through molecular docking, it has shown a strong affinity for epidermal growth factor (EGF), making it an essential tool for researchers studying EGF-related pathways.CLPP antibody
The CLPP antibody is a highly specialized biomolecule that belongs to the class of monoclonal antibodies. It specifically targets chemokine binding proteins and has been widely used in life sciences research. This monoclonal antibody has a high affinity for its target and can be used for various applications, including immunoassays, protein detection, and cell signaling studies. The CLPP antibody has been shown to have cytotoxic effects on activated cells and can be used as a tool for targeted therapy. It can also be immobilized on electrodes or collagen matrices for use in biosensors or tissue engineering applications. With its exceptional specificity and versatility, the CLPP antibody is an invaluable tool in the field of molecular biology and biomedical research.ALK antibody
The ALK antibody is a powerful tool in the field of Life Sciences. This antibody is specifically designed to target and bind to ALK (anaplastic lymphoma kinase), a protein that plays a crucial role in cell growth and division. By binding to ALK, this antibody can help researchers study its function and investigate its involvement in various diseases.
RPL3 antibody
RPL3 antibody was raised using the N terminal of RPL3 corresponding to a region with amino acids DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVCDH1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Through various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it undergoes metabolization. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth. Choose 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for a powerful solution against tuberculosis.PECAM1 antibody
The PECAM1 antibody is a monoclonal antibody that is water-soluble and specifically targets the PECAM1 protein. It has been shown to be effective in various applications such as diagnostic agents, pharmacologic studies, and life sciences research. The antibody can be used in experiments involving reaction solutions, electrophoresis, and enzyme-linked immunosorbent assays (ELISA). Additionally, it has been used to detect autoantibodies in human serum samples. The PECAM1 antibody is a valuable tool for researchers and scientists looking to study the function and expression of the PECAM1 protein.S100P antibody
The S100P antibody is a monoclonal antibody that targets the protein S100P. S100P is a chemokine-like protein that has been implicated in various biological processes, including cell growth, differentiation, and inflammation. It is also associated with certain diseases, such as circovirus infection and cancer.Alkaline Phosphatase antibody
Alkaline phosphatase antibody was raised in mouse using purified human placenta ALP as the immunogen.C16ORF48 antibody
C16ORF48 antibody was raised using the C terminal Of C16Orf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELVRAB22A antibody
The RAB22A antibody is a highly specialized monoclonal antibody that targets the glycan structures found in human serum. This antibody has been extensively studied and has shown promising results in various areas of research, including cancer biology and immunology.
KLHL13 antibody
KLHL13 antibody was raised in Mouse using a purified recombinant fragment of human KLHL13 expressed in E. coli as the immunogen.Cytokeratin 19 antibody
Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDN
KIF23 antibody
KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTPOU4F3 antibody
The POU4F3 antibody is a highly specialized monoclonal antibody that has various applications in the field of neurology and virology. It has been shown to have neuroprotective properties, making it a valuable tool for studying neurological disorders and potential therapeutic interventions. Additionally, this antibody exhibits antiviral activity by interfering with viral replication processes.NUDT18 antibody
NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF
CD40 antibody
The CD40 antibody is a powerful tool used in the field of Life Sciences. It acts by binding to the CD40 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to have numerous applications.
FGFR2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exerting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.Cystatin C antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.PRPF8 antibody
PRPF8 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRJAK1 antibody
The JAK1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets specific proteins, such as telomerase, cxcr4, and chemokine receptors, to inhibit their activity. This antibody has been shown to induce necrosis factor-related apoptosis-inducing cell death in various cell types, making it a valuable tool for cytotoxic studies. Additionally, the JAK1 antibody can be used to detect and quantify autoantibodies in patient samples, aiding in the diagnosis of autoimmune diseases. It has also been found to have potential therapeutic applications for conditions such as thrombocytopenia and nephrotoxicity. With its high specificity and efficacy, the JAK1 antibody is an essential tool for researchers studying growth factors and signaling pathways in various biological systems.Beta Lactamase antibody
Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL
SPARC antibody
The SPARC antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the SPARC protein, which plays a crucial role in various biological processes. The antibody binds to SPARC and inhibits its activity, making it a valuable tool for studying the function of this protein.
HSP60 antibody
The HSP60 antibody is a neuroprotective agent that belongs to the family of endothelial growth factors. It acts as a neurotrophic factor, promoting the growth and survival of neurons. This antibody is colloidal in nature and is widely used in Life Sciences research. It is a monoclonal antibody specifically designed to target and neutralize endothelial growth factor, which plays a crucial role in angiogenesis and vascular development. The HSP60 antibody can also be used to detect the presence of specific antigens, such as circumsporozoite protein, in biological samples. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying various aspects of cell biology and immunology.
