Primary Antibodies

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Affinity purified Rabbit polyclonal DDX56 antibody</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>Rabbit polyclonal POLD2 antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>FAF1 antibody was raised in rabbit using the C terminal of FAF1 as the immunogen</p>

<p>MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>