Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,624 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75324 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Granulysin antibody
<p>Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP</p>FGFR3 antibody
<p>The FGFR3 antibody is a histidine-rich interferon family kinase inhibitor that is widely used in the Life Sciences field. It possesses strong inhibitory properties, particularly against diacylglycerol, making it an effective tool for studying various cellular processes. This monoclonal antibody specifically targets and binds to the glycoprotein FGFR3, blocking its activity and preventing the activation of downstream signaling pathways. By inhibiting FGFR3, this antibody can interfere with epidermal growth factor-mediated cell proliferation and survival. Additionally, it has cytotoxic effects on cancer cells that overexpress FGFR3, making it a potential therapeutic option for certain types of cancers. The FGFR3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with versatile tools for their experiments.</p>FosB antibody
<p>The FosB antibody is a highly specialized antibody that acts as an inhibitor in various biological processes. It belongs to the class of polyclonal antibodies and is known for its ability to neutralize specific molecules such as natriuretic peptides, epidermal growth factor, and helicobacter pylori. Additionally, this antibody has been shown to have a neutralizing effect on tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation and immune response.</p>C-myc antibody (HRP)
<p>C-myc antibody (HRP) was raised in goat using a synthetic peptide representing amino acid residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>AQP1 antibody
The AQP1 antibody is a growth factor that belongs to the class of monoclonal antibodies. It has been shown to inhibit the multidrug resistance protein and enhance the expression of E-cadherin, a cell adhesion molecule. This antibody specifically targets AQP1, which is a water channel protein involved in various physiological processes. The AQP1 antibody has been extensively used in life sciences research to study its role in different cellular pathways. Additionally, it has been found to have cytotoxic effects on cancer cells and can interfere with nuclear signaling pathways. Its potential as a therapeutic agent is being explored in various fields, including oncology and immunology.IGF1R antibody
<p>The IGF1R antibody is a highly specialized product in the field of Life Sciences. It specifically targets the growth factor-1 receptor, which plays a crucial role in cellular growth and development. This antibody has been extensively studied and proven to be effective in various assays and experiments.</p>Alkaline Phosphatase antibody
Alkaline phosphatase antibody was raised in mouse using human placental alkaline phosphatase as the immunogen.PLCG2 antibody
<p>The PLCG2 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets PLCG2, an enzyme involved in various cellular processes. This antibody has been widely used to study the role of PLCG2 in signal transduction pathways and its association with diseases.</p>UPF3B antibody
<p>UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL</p>TRIM32 antibody
<p>The TRIM32 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the TRIM32 protein, which is an important molecule involved in various cellular processes. This polyclonal antibody is produced by immunizing animals with the target molecule, resulting in a diverse range of antibodies that can recognize different epitopes on TRIM32.</p>SNRPB antibody
<p>SNRPB antibody was raised using the middle region of SNRPB corresponding to a region with amino acids LRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMP</p>SCG2 antibody
<p>SCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ</p>Norovirus G2 antibody
The Norovirus G2 antibody is a highly effective and specific monoclonal antibody that is widely used in immunoassays in the field of Life Sciences. This antibody has neutralizing properties, making it an essential tool for researchers studying norovirus infections. It targets the tyrosine kinase receptor on norovirus particles, preventing their attachment to host cells and subsequent infection.IRF7 antibody
IRF7 antibody was raised in mouse using recombinant human IRF-7 (1-150aa) purified from E. coli as the immunogen.Androgen Receptor antibody
<p>The Androgen Receptor antibody is a powerful tool used in Life Sciences research. It is available as both Polyclonal Antibodies and Monoclonal Antibodies, providing researchers with options to suit their specific needs. This antibody targets the Androgen Receptor, a protein that plays a crucial role in steroid signaling and growth factor regulation.</p>TRIM2 antibody
<p>The TRIM2 antibody is a monoclonal antibody that specifically targets insulin, glucagon, and alpha-fetoprotein. It is widely used in Life Sciences research to study the role of these hormones in various physiological processes. The TRIM2 antibody has been shown to have cytotoxic effects on cells expressing high levels of insulin, making it a valuable tool for studying insulin-related disorders such as diabetes. Additionally, this antibody can be used in combination with other antibodies, such as anti-ICOS antibodies or annexin A2 antibodies, to investigate complex signaling pathways and protein interactions. The TRIM2 antibody is highly specific and exhibits strong binding affinity to its target proteins in human serum samples. Its versatility and reliability make it an indispensable tool for scientists working in the field of molecular biology and biomedical research.</p>SERCA1 antibody
<p>The SERCA1 antibody is a highly specialized antibody that plays a crucial role in nitrogen metabolism. It belongs to the class of imidazolidine derivatives and has neutralizing properties. This antibody is used in various research applications, including the development of monoclonal antibodies for targeted therapies. It has been shown to inhibit the activity of TNF-α (tumor necrosis factor-alpha), a growth factor involved in inflammation and immune response. Additionally, the SERCA1 antibody has been found to interact with other proteins such as usnic acid and the rubisco enzyme, further highlighting its versatility and potential applications. Polyclonal Antibodies specific to SERCA1 are also available, providing researchers with a comprehensive toolset for their studies. Furthermore, this antibody has shown interactions with cyanobacterial proteins, interleukin-6, hepcidin, and parathyroid hormone-related peptide, suggesting its involvement in various biological processes and signaling pathways. With its wide range of applications and potential therapeutic</p>GLP1R antibody
<p>The GLP1R antibody is a peptide nucleic acid that specifically binds to GLP-1 receptor (GLP1R) binding proteins. It is a polyclonal antibody commonly used in Life Sciences research. This antibody has been shown to block the activation of factor-α, a key mediator of inflammation. Additionally, it has been demonstrated to enhance the natriuretic response in animal models. The GLP1R antibody can be used in various experimental techniques such as electrode assays, botulinum toxin studies, and β-catenin signaling analysis. This high-quality antibody is produced using state-of-the-art technology and undergoes rigorous quality control testing to ensure optimal performance. Order now and unlock new insights into GLP-1 receptor biology.</p>Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.S100PBP antibody
<p>S100PBP antibody was raised using the middle region of S100PBP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ</p>MCPH1 antibody
<p>The MCPH1 antibody is a highly specialized antibody that targets the protein MCPH1. This protein plays a crucial role in various biological processes, including collagen synthesis, phosphorylation site regulation, and antinociceptive activity. The MCPH1 antibody is widely used in Life Sciences research to study the function and regulation of this protein.</p>LRRC23 antibody
<p>LRRC23 antibody was raised using the N terminal of LRRC23 corresponding to a region with amino acids LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN</p>MTRF1L antibody
MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQKIR2DL4 antibody
<p>KIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR</p>CHD1L antibody
<p>The CHD1L antibody is a polyclonal antibody that targets the growth factor CHD1L. It can be used in various applications, including insulin antibody assays and as a research tool for studying the role of CHD1L in different biological processes. This antibody has also been used in combination with other antibodies, such as trastuzumab, to detect specific proteins or biomarkers in samples. Additionally, it has shown reactivity with thymidylate synthase and anti-HER2 antibodies in human serum, making it a valuable tool for diagnostic purposes. The CHD1L antibody can be used in both monoclonal and polyclonal forms, offering flexibility for different experimental setups. Its specificity towards glial fibrillary acidic protein (GFAP) makes it particularly useful for studying autoimmune diseases or neurological disorders involving GFAP autoantibodies. Researchers can rely on this antibody to provide accurate and reliable results in their investigations.</p>Apolipoprotein A1 antibody
<p>The Apolipoprotein A1 antibody is a polyclonal antibody that specifically targets and binds to apolipoprotein A1, a protein involved in lipid metabolism. This antibody is widely used in life sciences research to study the functions and interactions of apolipoprotein A1 in various biological processes.</p>ASNS antibody
The ASNS antibody is a monoclonal antibody that specifically targets the asparagine synthetase (ASNS) protein. This protein plays a crucial role in cellular growth and metabolism by catalyzing the conversion of aspartate to asparagine. The ASNS antibody can be used in various research applications, including immunoassays, Western blotting, and immunohistochemistry.EMR2 antibody
<p>The EMR2 antibody is a highly specific monoclonal antibody that targets the EMR2 antigen. This antigen plays a crucial role in various cellular processes, including interleukin-6 signaling, antibody-drug conjugate internalization, nuclear localization, glycosylation, phosphatase activity regulation, and exocytosis.</p>Glycogen Synthase 2 antibody
Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDP2RX4 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, making it highly efficient in treating tuberculosis infections. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>BRAF antibody
<p>The BRAF antibody is a highly potent monoclonal antibody that belongs to the group of chemokine antibodies. It exhibits strong cytotoxic and antitumor activity, making it an effective treatment for various types of cancer. This antibody specifically targets BRAF, a protein involved in cell growth and division, and neutralizes its function. By inhibiting BRAF, the antibody prevents the growth and spread of cancer cells.</p>AXL antibody
<p>The AXL antibody is a highly specific monoclonal antibody that targets the AXL receptor tyrosine kinase. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been validated for use in multiple species and has shown high specificity and sensitivity.</p>CNDP2 antibody
CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCCPA1 antibody
<p>The CPA1 antibody is a highly reactive monoclonal antibody that is used in antiestrogen therapy. It specifically targets and binds to the fatty acid CPA1, inhibiting its activity. This antibody has been shown to block the interaction between CPA1 and interleukin-6, a growth factor involved in cancer cell proliferation. Additionally, the CPA1 antibody acts as a potent inhibitor of protein kinase activity, specifically targeting the CDK4/6 pathway. This makes it an effective tool for studying cell cycle regulation and potential therapeutic applications. With its high specificity and affinity, the CPA1 antibody is a valuable asset in life sciences research.</p>HNF4A antibody
HNF4A antibody was raised using the middle region of HNF4A corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYIMyoglobin antibody
<p>The Myoglobin antibody is a highly specific and effective tool used in spectrometric and electrode-based assays. This Monoclonal Antibody has been developed to target the myoglobin protein, which plays a crucial role in oxygen storage and transport in muscle tissues. The Myoglobin antibody has been extensively tested and proven to have neutralizing properties against myoglobin, making it an ideal choice for research studies involving myoglobin-related processes.</p>COX2 antibody
<p>COX2 antibody is a polyclonal antibody that specifically targets cyclooxygenase-2 (COX-2), an enzyme involved in the production of inflammatory prostaglandins. This antibody is commonly used in research to study the role of COX-2 in various biological processes. It has been shown to be effective in detecting COX-2 expression in blood plasma and various tissues, including actin filaments and alpha-synuclein (α-syn). The COX2 antibody can be used for immunohistochemistry, Western blotting, and other applications to investigate the expression and localization of COX-2 in different cell types and tissues. Its high specificity and sensitivity make it a valuable tool for researchers studying the role of COX-2 in inflammation, cancer, and other diseases.</p>Complement C5b antibody
<p>Complement C5b antibody was raised in mouse using activated human complement component C5 as the immunogen.</p>NECAP2 antibody
NECAP2 antibody was raised using the N terminal of NECAP2 corresponding to a region with amino acids WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVFYB antibody
FYB antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the potassium channel and acts as a drug antibody. FYB antibody has been extensively studied and validated for its application in various research techniques, including immunohistochemistry and in-situ assays. It is highly specific and shows excellent affinity towards its target.GPR110 antibody
<p>The GPR110 antibody is a highly effective tool for targeting and inhibiting the activity of GPR110, a receptor that plays a crucial role in various cellular processes. This monoclonal antibody has been extensively studied and shown to effectively block the activation of GPR110, leading to a decrease in cortisol concentration and growth factor signaling.</p>FLT3 antibody
<p>The FLT3 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to the FLT3 receptor, which plays a crucial role in cell growth and differentiation. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>FAH antibody
<p>FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT</p>FIR antibody
The FIR antibody is a polyclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the botulinum toxin, making it an essential tool for research and diagnostic purposes. This antibody has been extensively tested and proven to be highly effective in detecting and quantifying the presence of botulinum toxin in various samples. The FIR antibody can be used in combination with other monoclonal antibodies to enhance its cytotoxic effects, allowing for more accurate and reliable results. Its unique composition and high specificity make it an invaluable asset in the fight against botulinum toxin-related diseases. Additionally, this antibody has shown promising results as an anti-Mertk antibody, which makes it a potential candidate for developing novel therapies targeting Mertk family kinases. With its wide range of applications and exceptional performance, the FIR antibody is a must-have tool for any researcher or scientist working in the field of botulinum toxin research.
