Primary Antibodies

<p>Goat anti-monkey IgM (Alk Phos) was raised in goat using monkey IgM as the immunogen.</p>

<p>FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ</p>

<p>RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK</p>

Mouse monoclonal PAI1 antibody

<p>Purified Polyclonal POLR1A antibody</p>

<p>DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK</p>

<p>ACTR10 antibody was raised in Rabbit using Human ACTR10 as the immunogen</p>

<p>Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA</p>

<p>Rabbit polyclonal NOP56 antibody</p>

<p>The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.</p>

<p>The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>

<p>Rabbit polyclonal SHIP1 antibody (Tyr1021)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro</p>

<p>DCX antibody was raised in Rabbit using Human DCX as the immunogen</p>

<p>Rabbit polyclonal NGAL antibody (biotin)</p>

Rabbit polyclonal CCL7 antibody (HRP)

<p>The NeuroD antibody is a highly specialized monoclonal antibody that has been developed for research purposes in the field of Life Sciences. It is specifically designed to target and detect the presence of NeuroD, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity, making it an ideal tool for studying the function and expression of NeuroD in different biological systems.</p>

<p>GCK antibody was raised in Rabbit using Human GCK as the immunogen</p>

CD54 antibody was raised in mouse using human monocytes as the immunogen.

<p>U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

Rabbit polyclonal GABARAPL2 antibody (biotin)

Rabbit polyclonal OR10G7 antibody

<p>CTSL2 antibody was raised in rabbit using the C terminal of CTSL2 as the immunogen</p>

<p>The VHL antibody is a multidrug monoclonal antibody that specifically targets molecules involved in endothelial growth. It is widely used in Life Sciences research to study the role of growth factors, chemokines, and other signaling molecules in various cellular processes. This antibody has been shown to effectively neutralize the activity of activated growth factors, leading to a decrease in cell proliferation and migration. Additionally, it has demonstrated cytotoxic effects on cancer cells through its ability to induce cell death via various mechanisms, including hybridization and cell cytotoxicity. The VHL antibody is an essential tool for researchers studying angiogenesis, tumor biology, and therapeutic development.</p>

<p>Affinity purified Rabbit polyclonal KLRC4 antibody</p>

<p>Affinity purified Rabbit polyclonal Integrin alpha 2b antibody</p>

<p>The Doublecortin antibody is a highly specialized antibody that is activated by plasmin activity. It is commonly used in Life Sciences research to study protein-protein interactions and proteolytic processes. This antibody specifically targets hepcidin, a peptide hormone involved in iron metabolism, and has been shown to have neuroprotective effects. Additionally, the Doublecortin antibody has been found to inhibit glutamate-induced cell cytotoxicity and fibrinogen binding. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the best option for their specific needs. With its high specificity and ability to target specific amino acid residues, the Doublecortin antibody is a valuable tool in various research applications.</p>

<p>RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP</p>

<p>ROCK2 antibody was raised in rabbit using the middle region of ROCK2 as the immunogen</p>

<p>Rabbit polyclonal BCL-XL antibody (Thr115)</p>

<p>CDH3 antibody was raised in Rabbit using Human CDH3 as the immunogen</p>

<p>Rabbit polyclonal RPS14 antibody (biotin)</p>

<p>Rabbit polyclonal bRAF antibody (Thr753)</p>

<p>SH3BP5 antibody was raised in rabbit using the C terminal of SH3BP5 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal ENTPD6 antibody</p>

<p>CD49b antibody (Azide free) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>

<p>Rabbit polyclonal GSK3 beta antibody</p>

Rabbit polyclonal CSNK1E antibody (FITC)

<p>CCT6B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL</p>

GFAP antibody was raised in mouse using intermediate filament cytoskeleton from cultured human glioma cells as the immunogen.

<p>NT5DC1 antibody was raised using the N terminal of NT5DC1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF</p>

<p>The JAB1 antibody is a highly specialized product in the field of Life Sciences. It is an anti-mesothelin antibody that specifically binds to mesothelin, a protein involved in cell growth and differentiation. This antibody has been extensively studied and shown to have neutralizing properties against mesothelin, making it a valuable tool for research purposes.</p>

<p>CD72.1 antibody was raised in mouse using DBA/2 murine spleen cells as the immunogen.</p>

<p>The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.</p>

<p>Rabbit polyclonal MYST1 antibody</p>

<p>C6ORF134 antibody was raised using the middle region of C6Orf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID</p>

<p>FLOT1 antibody was raised in Rabbit using Human FLOT1 as the immunogen</p>

<p>ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV</p>

<p>APLP2 antibody was raised in Rabbit using Human APLP2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal PRPS2 antibody</p>

Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

<p>Lamin A+C Monoclonal Antibody</p>

hnRNP A2B1 Monoclonal Antibody

Rabbit polyclonal FGF21 antibody (biotin)

<p>REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT</p>

<p>The HSPG2 antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It has been extensively studied for its role in osteopontin regulation and e-cadherin expression. Additionally, this antibody has shown potential in targeting amyloid plaque formation and inhibiting oncostatin activity.</p>

<p>NINJ2 antibody was raised in Rabbit using Human NINJ2 as the immunogen</p>

<p>Rabbit polyclonal ZNF397 antibody</p>

<p>APOBEC4 antibody was raised in Rabbit using Human APOBEC4 as the immunogen</p>

<p>ABHD14B antibody was raised in Rabbit using Human ABHD14B as the immunogen</p>

<p>NUDT21 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV</p>

<p>The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.</p>

The HDAC1 antibody is a highly specialized product in the field of Life Sciences. It is a glycopeptide that specifically targets and binds to the HDAC1 protein, which plays a crucial role in gene expression regulation. This antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific experimental needs.

<p>The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.</p>

<p>Affinity purified Rabbit polyclonal BCLx antibody</p>

<p>Rabbit polyclonal ZNF23 antibody</p>

<p>Rabbit polyclonal OR10A5 antibody</p>

<p>CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal HHIP antibody</p>

<p>Rabbit polyclonal Caldesmon antibody (Ser759)</p>

<p>AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for its remarkable effectiveness against tuberculosis.</p>

Rabbit polyclonal NGAL antibody (HRP)

<p>PPP1R7 antibody was raised using a synthetic peptide corresponding to a region with amino acids QNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN</p>

<p>FLT1 antibody was raised in Rabbit using Human FLT1 as the immunogen</p>

<p>TBC1D22A antibody was raised using the N terminal of TBC1D22A corresponding to a region with amino acids RQGRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAESAS</p>

<p>FMR1 antibody was raised in Mouse using a purified recombinant fragment of human FMR1 expressed in E. coli as the immunogen.</p>

<p>Affinity purified Mouse polyclonal XRCC1 antibody</p>

<p>AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL</p>

<p>ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS</p>

<p>CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD</p>

<p>BLK antibody was raised in Mouse using a purified recombinant fragment of BLK expressed in E. coli as the immunogen.</p>

<p>ATE1 antibody was raised in Rabbit using Human ATE1 as the immunogen</p>

<p>Purified Polyclonal POLR3C antibody</p>

<p>VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF</p>

Please enquire for more information about CXCL9 antibody (Biotin) including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Rabbit polyclonal DLEC1 antibody</p>

<p>NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY</p>

<p>The ORC2 antibody is a highly effective tool in the field of life sciences. It is an activated polyclonal antibody that specifically targets endocytic uptake. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. The ORC2 antibody is also available as a monoclonal antibody for more specific targeting. It has been extensively tested and proven to have high affinity and specificity for its target antigen. Additionally, this antibody has been found to be highly effective in neutralizing the cytotoxic effects of certain pathogens, such as Bacillus thuringiensis. Its colloidal properties allow for easy conjugation with other molecules, making it a versatile tool for research purposes. With its ability to interfere with interferon signaling pathways and modulate fatty acid metabolism, the ORC2 antibody opens up new possibilities for studying these biological processes.</p>

<p>Flt1 antibody was raised in mouse using recombinant human FLT1/VEGFR1 protein EC-domain as the immunogen.</p>

Rabbit polyclonal Aldolase antibody (HRP)

<p>Rabbit Polyclonal elF4E antibody (Ser209)</p>

<p>C3orf33 antibody was raised using the middle region of C3orf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR</p>

ARMC8 antibody was raised in Rabbit using Human ARMC8 as the immunogen

<p>ABCG4 antibody was raised in Rabbit using Human ABCG4 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Neuregulin 2 antibody</p>

<p>Rabbit polyclonal Claudin 6 antibody (Tyr219)</p>

BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.

<p>The APLP2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets the APLP2 protein, which plays a crucial role in various biological processes. The APLP2 antibody is designed to recognize and bind to specific regions of the APLP2 protein, allowing for precise detection and analysis.</p>