Primary Antibodies

<p>AKR1B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN</p>

<p>Rabbit polyclonal XRCC1 antibody</p>

Mouse monoclonal ACY3 antibody

Mouse macrophage antibody (FITC) was raised in rabbit using mouse macrophages as the immunogen.

<p>Rabbit polyclonal RABEPK antibody</p>

<p>CCNB1IP1 antibody was raised in mouse using recombinant Human Cyclin B1 Interacting Protein 1 (Ccnb1Ip1)</p>

<p>Mouse monoclonal LACTB2 antibody</p>

<p>LNPEP antibody was raised in Rabbit using Human LNPEP as the immunogen</p>

Rat monoclonal CD45R antibody (allophycocyanin)

Purified Rabbit polyclonal MGST1 antibody

<p>FABP antibody was raised in mouse using human heart FABP as the immunogen.</p>

AND1 antibody was raised in mouse using Nuclear fraction prepared from Xenopus laevis oocytes as the immunogen.

<p>The L1CAM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets L1CAM, a glycoprotein involved in cell adhesion and migration. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>The LIMK1 antibody is a highly effective medicament used in immunoassays. It belongs to the class of Monoclonal Antibodies and is widely used in the field of Life Sciences. This antibody specifically targets and binds to LIMK1, a phosphatase that plays a crucial role in cell growth and migration. By binding to LIMK1, this antibody inhibits its activity and disrupts the signaling pathways associated with growth factors and tyrosine kinase receptors.</p>

BTBD10 antibody was raised in Rabbit using Human BTBD10 as the immunogen

Mouse monoclonal CAPZA1 antibody

The GOLM1 antibody is a powerful tool in the field of Life Sciences. It is an anti-MERTK antibody that has been extensively studied for its antiviral and cytotoxic properties. This monoclonal antibody specifically targets the GOLM1 protein, also known as Golgi membrane protein 1, which plays a crucial role in various cellular processes.

<p>The Human Nuclei antibody is a monoclonal antibody that specifically targets the nuclei of human cells. It recognizes sugar moieties on nuclear proteins and can be used for various applications in life sciences research. This antibody has been shown to be highly specific and sensitive, allowing for accurate detection of human nuclei in tissue samples.</p>

<p>BIRC8 antibody was raised in Rabbit using Human BIRC8 as the immunogen</p>

<p>MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV</p>

<p>Rabbit polyclonal RPL3L antibody</p>

<p>HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK</p>

Rabbit polyclonal HNRNPD antibody (FITC)

The FYN antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostic applications to detect and study GFAP expression. GFAP is an intermediate filament protein that is highly expressed in astrocytes, a type of glial cell in the central nervous system. The FYN antibody can be used to visualize and quantify GFAP levels in various tissues and cell types, providing valuable insights into the role of astrocytes in neurological diseases and disorders.

Rat monoclonal IL21R antibody (biotin)

<p>The FZD4 antibody is a highly active agent that functions as a steroid receptor. It has been extensively studied and proven to effectively modulate cortisol concentration in various experimental settings. This antibody has shown promising results in inhibiting the growth of MCF-7 cells, particularly when used in combination with trastuzumab and epidermal growth factor. Additionally, it has demonstrated its efficacy in targeting low-density lipoprotein receptors, making it a valuable tool in Life Sciences research. The FZD4 antibody also plays a crucial role in the detection and analysis of autoantibodies and serves as an essential component for the development of inhibitors and monoclonal antibodies. With its exceptional specificity and reliability, this antibody offers immense potential for advancing scientific discoveries in the field of cortisol regulation and related areas.</p>

<p>Rabbit polyclonal SAT1 antibody (HRP)</p>

MLF2 antibody was raised using the middle region of MLF2 corresponding to a region with amino acids DSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAF

<p>EEF1A2 antibody was raised using the middle region of EEF1A2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP</p>

<p>Purified Rabbit polyclonal PDCD10 antibody</p>

xNopp180 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.

<p>Purified Rabbit polyclonal Chk1 antibody (Ser280)</p>

The GMCSF antibody is a neutralizing antibody that acts as an inhibitor in the field of Life Sciences. It targets and binds to tyrosine residues, preventing the activation of certain cellular pathways. This antibody can be used in various applications such as immunohistochemistry, where it helps visualize specific proteins or cells of interest. Additionally, the GMCSF antibody has been shown to have therapeutic potential in conditions like endotoxemia, where it can neutralize the effects of inflammatory cytokines like TNF-α. It has also been studied for its role in modulating actin dynamics and regulating cellular responses to stimuli. The GMCSF antibody is commonly used in research settings and is available as a purified form for easy use.

Rabbit polyclonal SERPINB6 antibody

<p>Purified Rabbit polyclonal BORG1 antibody</p>

Mouse monoclonal CCL2 antibody (allophycocyanin)

<p>GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC</p>

<p>Mouse monoclonal PSMD2 antibody</p>

The PAPPA antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the protein known as pregnancy-associated plasma protein A (PAPPA). This antibody is produced using advanced techniques and is carefully formulated to ensure optimal performance.

<p>C1orf50 antibody was raised in Rabbit using Human C1orf50 as the immunogen</p>

The SYNGR4 antibody is a highly advanced nanocomposite medicament that has shown remarkable efficacy in various applications within the field of Life Sciences. This monoclonal antibody, which has been pegylated for enhanced stability and bioavailability, exhibits exceptional binding affinity towards collagen in human serum. Through its unique mechanism of action, the SYNGR4 antibody effectively targets and neutralizes specific markers, such as alpha-fetoprotein, adeno-associated antibodies, and actin antibodies.

<p>Rabbit polyclonal Src antibody (Ser75)</p>

Rabbit polyclonal DAP1 antibody (HRP)

<p>Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED</p>

<p>CAPRIN2 antibody was raised in Rabbit using Human CAPRIN2 as the immunogen</p>

Mouse monoclonal GSTA3 antibody

<p>Rabbit polyclonal SNPH antibody</p>

<p>BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK</p>

<p>The HSP60 antibody is a monoclonal antibody that specifically targets heat shock protein 60 (HSP60). HSP60 is involved in various cellular processes, including protein folding and transport. This antibody has been shown to neutralize the activity of HSP60 and inhibit its function. It can be used in research and diagnostic applications to study the role of HSP60 in different biological systems. The HSP60 antibody has also been used to investigate the effects of HSP60 on cell signaling pathways, such as TGF-beta and epidermal growth factor, as well as its interaction with other proteins like transferrin. With its high specificity and affinity, this monoclonal antibody is a valuable tool for researchers in the life sciences field.</p>

The PAX5 antibody is a highly effective tool for research purposes. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs. This antibody has been extensively tested and proven to be reliable in various applications.

Rat monoclonal CD51 antibody (biotin)

Rabbit polyclonal SLPI antibody (HRP)

Rabbit polyclonal DFFA antibody

<p>The CEA antibody is a monoclonal antibody that specifically targets e-cadherin, a glycoprotein involved in cell adhesion. This antibody is designed to recognize and bind to e-cadherin, inhibiting its activity and preventing cell-cell interactions. The CEA antibody is commonly used in life sciences research and biochemical studies to investigate the role of e-cadherin in various cellular processes.</p>

<p>Rabbit polyclonal SCYL2 antibody</p>

<p>Mouse monoclonal MAPK8 antibody</p>

<p>Rat macrophage antibody (FITC) was raised in rabbit using rat macrophages as the immunogen.</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>The EPHA5 antibody is a highly specialized antibody that targets the epidermal growth factor. It plays a crucial role in various Life Sciences applications, particularly in the study of adipose tissues. This antibody has been shown to affect important cellular processes such as glycosylation and cell adhesion through its interaction with proteins like E-cadherin and β-catenin.</p>

<p>Rabbit polyclonal OR10J1 antibody</p>

CD4 antibody (PE) was raised in mouse using CD4+ transfectant/human CEM as the immunogen.

<p>Mouse monoclonal TULP3 antibody</p>

<p>Rat monoclonal IL4 antibody (allophycocyanin)</p>

C12orf11 antibody was raised in Rabbit using Human C12orf11 as the immunogen

<p>Rabbit polyclonal MYPT1 antibody (Thr696)</p>

<p>The NEK6 antibody is a highly specialized monoclonal antibody that is used in various applications within the Life Sciences field. It is designed to target and bind to NEK6, an enzyme involved in cell cycle regulation and signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Mouse monoclonal MGRN1 antibody</p>

<p>The CD70 antibody is a monoclonal antibody that targets the CD70 protein. It has been shown to inhibit the activity of phosphatase and nuclear factor kappa-light-chain-enhancer in B cells, leading to decreased polymerase activity and growth factor activation. This antibody also has cytotoxic effects on mycoplasma genitalium, as it activates endonuclease and caspase-9, resulting in cell death. The CD70 antibody is widely used in Life Sciences research and has potential applications in the development of targeted therapies for various diseases.</p>

<p>The NMT2 antibody is a highly specialized biological agent that has a range of important applications in the field of Life Sciences. This antibody is known for its high bioavailability and exceptional binding affinity to erythropoietin receptors. It has been extensively studied for its ability to modulate various biological effects, including angiogenic response and the production of polyunsaturated fatty acids such as arachidonic acid.</p>

<p>Mouse Monoclonal ACAT2 antibody</p>

<p>Purified Polyclonal LSM2 antibody</p>

<p>Mouse monoclonal ELK3 antibody</p>

<p>Mouse monoclonal EXOSC7 antibody</p>

The Cytokeratin Antibody Cocktail is a powerful tool for immunohistochemistry and research applications. This cocktail contains a mixture of monoclonal antibodies that specifically target various cytokeratins, which are intermediate filament proteins found in epithelial cells. These monoclonal antibodies have been extensively validated and provide high specificity and sensitivity in detecting cytokeratin expression.

<p>Mouse monoclonal NME4 antibody</p>

<p>The CDK5 antibody is a highly specialized monoclonal antibody that has neutralizing properties against cyclin-dependent kinase 5 (CDK5). CDK5 is an enzyme involved in various cellular processes, including cell cycle regulation and neuronal development. The CDK5 antibody acts as an inhibitor of CDK5 activity, leading to cytotoxic effects on targeted cells.</p>

IL1b antibody is a monoclonal antibody that specifically targets and neutralizes interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various biological processes. IL-1β plays a crucial role in the regulation of immune responses, cell growth, and differentiation. This antibody has been extensively used in research and life sciences to study the function of IL-1β and its inhibitors.

Rabbit polyclonal Transferrin antibody (FITC)

<p>Rabbit polyclonal XPNPEP3 antibody</p>

<p>Mouse monoclonal DNTTIP1 antibody</p>

<p>FAM84A antibody was raised using the N terminal of FAM84A corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD</p>

<p>RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR</p>

<p>Rabbit polyclonal MNK1 antibody</p>

<p>Rabbit polyclonal BTF3L3 antibody</p>

<p>ALS2CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP</p>

<p>Goat anti-Mouse IgG + IgM (HRP) was raised in goat using purified Mouse IgG + IgM as the immunogen.</p>

IL2 antibody was raised in Mouse using recombinant human IL-2 as the immunogen.

<p>Purified Polyclonal ZO3 antibody</p>

Rabbit polyclonal SAMD4A antibody

Mouse monoclonal POLR2E antibody

Purified Polyclonal NAV3 antibody

<p>The S6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize collagen, a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be effective in inhibiting collagen's genotoxic effects.</p>

<p>The DEFB1 antibody is a growth factor and family kinase inhibitor protein that is widely used in Life Sciences research. This specific antibody is designed to bind to DEFB1, also known as human beta-defensin 1. It has been extensively validated for its high specificity and affinity towards DEFB1, making it an essential tool for studying the function and regulation of this important protein.</p>

<p>Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE</p>

<p>Rabbit polyclonal RPC4 antibody</p>

<p>Mouse monoclonal JEV PreM antibody</p>

The ERBB2 antibody is a monoclonal antibody that acts as a family kinase inhibitor. It specifically targets the epidermal growth factor receptor 2 (ERBB2), which is known to play a critical role in the growth and proliferation of cancer cells. This antibody effectively inhibits the binding of growth factors, such as epidermal growth factor and interleukin-6, to the ERBB2 receptor, thereby preventing the activation of downstream signaling pathways that promote tumor growth.

C2ORF25 antibody was raised using the middle region of C2Orf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI

<p>The VEGFR1 antibody is a powerful diagnostic reagent used in Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes Vascular Endothelial Growth Factor Receptor 1 (VEGFR1). This antibody has cytotoxic properties and is reactive against various growth factors. It can be used for the quantitation of VEGFR1 expression in different tissues, including adipose tissue. The VEGFR1 antibody is highly specific and can be used as an inhibitor in research studies or as a diagnostic tool in clinical settings. Its polymorphic nature allows for versatility and adaptability to different experimental conditions. With its high-quality production and reliable performance, this antibody is an essential tool for researchers and clinicians alike.</p>

<p>The Lin28B antibody is an effective molecular inhibitor that has shown promising results as an anticancer agent. It specifically targets the Lin28B protein, a key regulator of cancer progression. By inhibiting the activity of this protein, the antibody can effectively inhibit tumor growth and metastasis. This antibody is a valuable tool in cancer research and can be used in various applications such as chemotherapy and molecular biology studies. With its high specificity and potency, the Lin28B antibody offers great potential for developing novel therapeutic strategies against cancer.</p>