Primary Antibodies

<p>Affinity purified Mouse polyclonal NELL2 antibody</p>

<p>Purified Polyclonal SFRS11 antibody</p>

Rabbit polyclonal Ovomucoid antibody (FITC)

<p>DOCK3 antibody was raised in Rabbit using Human DOCK3 as the immunogen</p>

<p>The MASP2 antibody is a highly specialized monoclonal antibody used in immunoassays and research within the Life Sciences field. It is designed to specifically target and bind to the MASP2 protein, which plays a crucial role in the activation of the complement system.</p>

<p>The FITC antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that is designed to neutralize specific targets. The FITC antibody has been extensively studied and optimized for use in various applications, including immunoassays, flow cytometry, and immunohistochemistry.</p>

<p>CDCA2 antibody was raised in Rabbit using Human CDCA2 as the immunogen</p>

<p>The Myc antibody is a highly specialized antibody that targets and binds to the c-Myc protein. This protein plays a crucial role in various cellular processes, including cell growth, proliferation, and differentiation. The Myc antibody is widely used in life sciences research to study the function and regulation of c-Myc.</p>

Rabbit polyclonal Rab1A antibody (biotin)

<p>Purified Polyclonal CUGBP1 antibody</p>

<p>Rabbit polyclonal CASP1 antibody</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV</p>

<p>NFKB1 antibody was raised in Rabbit using Human NFKB1 as the immunogen</p>

<p>ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERH</p>

Metadherin antibody was raised in Mouse using a purified recombinant fragment of human MTDH expressed in E. coli as the immunogen.

<p>The ARG2 antibody is a highly specialized antibody that has a wide range of applications in the field of life sciences. It is commonly used in various assays and experiments to study the role of ARG2 in different biological processes.</p>

Rabbit polyclonal Transgelin antibody (HRP)

<p>MLL antibody was raised in Mouse using a purified recombinant fragment of MLL(aa3751-3968) expressed in E. coli as the immunogen.</p>

<p>The PDZK1 antibody is a highly specialized molecule drug that falls under the category of antibodies in the Life Sciences field. It is designed to target a specific molecule known as PDZK1. This antibody can be used for various applications, including research and diagnostic purposes.</p>

<p>HBS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH</p>

Rabbit Polyclonal mTOR antibody (Ser2448)

<p>TIA1 antibody was raised using the C terminal of TIA1 corresponding to a region with amino acids QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ</p>

<p>The ARF6 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the ARF6 protein, which plays a crucial role in various cellular processes such as epidermal growth factor signaling and nuclear transport. This antibody has been extensively studied and has shown promising results in various applications.</p>

<p>GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV</p>

<p>Affinity purified Rabbit polyclonal WNT10A antibody</p>

<p>The MAGE1 antibody is a highly specialized molecular weight complex that acts as a cation channel in sodium citrate. It is widely used in the field of Life Sciences for its ability to facilitate antigen-antibody reactions. This monoclonal antibody, along with Polyclonal Antibodies, has been extensively studied for its interactions with platelet fibrinogen and its DNA binding activity. With its unique composition of acid residues, the MAGE1 antibody exhibits exceptional binding affinity to various targets. It is commonly employed in research laboratories for applications such as immunohistochemistry, western blotting, and ELISA assays. Furthermore, this antibody has proven to be effective in human serum and nuclear extracts, making it an invaluable tool for studying cellular processes and disease mechanisms.</p>

<p>APEX1 antibody was raised in Rabbit using Human APEX1 as the immunogen</p>

The PTCH1 antibody is a powerful tool in the field of Life Sciences. It is widely used for various research purposes, including the study of excipients, multidrug resistance, fibronectin interaction, protein complex formation, and neutralizing growth factors. This monoclonal antibody specifically targets the PTCH1 protein, which plays a crucial role in cell signaling pathways. By binding to PTCH1, this antibody inhibits its activity and prevents downstream signaling events. Additionally, it has been shown to have low cross-reactivity with other proteins, ensuring its specificity in experiments. Whether you are studying collagen synthesis, androgen regulation, or hepatocyte growth factor signaling, the PTCH1 antibody is an essential tool that will provide reliable and accurate results.

<p>EIF2C1 antibody was raised using the N terminal of EIF2C1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI</p>

<p>LOC653186 antibody was raised using the N terminal of LOC653186 corresponding to a region with amino acids MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL</p>

<p>MPO antibody was raised in rabbit using the N terminal of MPO as the immunogen</p>

<p>EBP antibody was raised in Rabbit using Human EBP as the immunogen</p>

<p>FIGNL1 antibody was raised in Rabbit using Human FIGNL1 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its potency has been demonstrated through patch-clamp technique studies on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets and binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

NELL2 antibody was raised in mouse using recombinant human NELL2 (30-258aa) purified from E. coli

<p>CD244 antibody was raised in rabbit using the C terminal of CD244 as the immunogen</p>

<p>PRSS1 antibody was raised in rabbit using the N terminal of PRSS1 as the immunogen</p>

<p>Purified Rabbit polyclonal TRHR antibody</p>

<p>CENPL antibody was raised in Rabbit using Human CENPL as the immunogen</p>

<p>IL4 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is commonly used in life sciences research and has various applications in the field. IL4 antibody can be used as a tool to study the role of interleukin-4 (IL-4) in immune responses and inflammation. It can also be used as an inhibitor to block the activity of IL-4, which is involved in anti-angiogenesis and other processes.</p>

<p>Rabbit polyclonal FKHR antibody (Ser319)</p>

<p>AFP antibody was raised in Rabbit using Human AFP as the immunogen</p>

<p>Affinity purified Rabbit polyclonal POLR2G antibody</p>

DNMT3A antibody was raised in Rabbit using Human DNMT3A as the immunogen

<p>Rabbit polyclonal Dab1 antibody</p>

<p>Rabbit polyclonal NUDT8 antibody</p>

The p53 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The antibody has been extensively tested and validated for its high specificity and activity.

<p>Purified Polyclonal TRIP13 antibody</p>

<p>Haptoglobin antibody is a monoclonal antibody that specifically targets haptoglobin, a human protein found in plasma. It is widely used in Life Sciences research to study the role of haptoglobin in various biological processes. Haptoglobin antibody has been shown to bind to haptoglobin expressed in human hepatocytes and inhibit its function. This antibody can also be used for immunohistochemistry and Western blotting to detect haptoglobin levels in human serum samples. Additionally, haptoglobin antibody has been used in studies investigating the interaction between haptoglobin and other molecules such as fatty acids, lectins, and transport proteins. Its specificity and high affinity make it a valuable tool for researchers studying the functions of haptoglobin and its polymorphic variants.</p>

<p>The FPR1 antibody is a highly specialized medicament used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to e-cadherin, a glycoprotein involved in cell adhesion. This colloidal antibody has been extensively studied for its inhibitory effects on e-cadherin expression and its potential as a therapeutic agent in various diseases.</p>

Rabbit polyclonal Cystatin C antibody (HRP)

<p>CPNE1 antibody was raised in Rabbit using Human CPNE1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Olfactory receptor 2A4 antibody</p>

<p>RIT1 antibody was raised in rabbit using the C terminal of RIT1 as the immunogen</p>

<p>The PAcP antibody is a powerful tool used in various Life Sciences assays. It is an antibody that specifically targets and binds to acid phosphatase (PAcP), an enzyme involved in DNA repair and recombination. This antibody can be used to detect the presence of PAcP in samples, allowing researchers to study its role in cellular processes.</p>

<p>Rabbit polyclonal PP14C antibody</p>

<p>ERC2 antibody was raised in Rabbit using Human ERC2 as the immunogen</p>

<p>C14ORF44 antibody was raised using the middle region of C14Orf44 corresponding to a region with amino acids AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ</p>

<p>Rabbit polyclonal p70 S6 Kinase antibody (Ser411)</p>

<p>Rabbit polyclonal PDGFRL antibody</p>

GAS2 antibody was raised in Rabbit using Human GAS2 as the immunogen

The MN1 antibody is a polyclonal antibody used in various applications within the Life Sciences field. It can be utilized for hybridization studies, electrophoresis, and neutralizing assays. This antibody has shown efficacy in inhibiting dopamine-induced agglutination and fibrinogen binding. Additionally, it has been found to have an impact on chemokine production in granulosa cells. The MN1 antibody is also commonly used for research involving erythropoietin, collagen, and interleukin-6. With its versatility and effectiveness, this antibody is a valuable tool for scientists conducting experiments in a wide range of disciplines within the Life Sciences field.

C20ORF20 antibody was raised using the middle region of C20Orf20 corresponding to a region with amino acids LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM

<p>TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen</p>

<p>ASAH1 antibody was raised in Rabbit using Human ASAH1 as the immunogen</p>

<p>DUS3L antibody was raised in Rabbit using Human DUS3L as the immunogen</p>

<p>THYN1 antibody was raised using the N terminal of THYN1 corresponding to a region with amino acids MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL</p>

Purified Polyclonal Carbonic Anhydrase 14 antibody

<p>Rabbit polyclonal AAK1 antibody</p>

<p>Affinity purified Rabbit polyclonal AIF1 antibody</p>

<p>The ERCC5 antibody is a powerful inhibitor that targets lyso-gb1, a substance involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a therapeutic agent. It is widely used in research laboratories and pharmaceutical companies for its ability to specifically bind to lyso-gb1 and inhibit its activity.</p>

<p>CD34 antibody was raised in rabbit using the C terminal of CD34 as the immunogen</p>

Rabbit polyclonal SOD1 antibody (HRP)

<p>Affinity purified Rabbit polyclonal EIF3K antibody</p>

<p>The HDAC8 antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to the histone deacetylase 8 (HDAC8) protein, which plays a crucial role in regulating gene expression. By targeting HDAC8, this antibody can modulate the activity of growth factors, tyrosine kinases, interferons, and fatty acids.</p>

<p>NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH</p>

GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG

<p>SYN3 antibody was raised in rabbit using the middle region of SYN3 as the immunogen</p>

<p>The UBC9 antibody is a polyclonal antibody that targets the UBC9 protein. UBC9 plays a crucial role in the modification of proteins by attaching small ubiquitin-like modifier (SUMO) proteins to target proteins. This process, known as SUMOylation, regulates various cellular processes such as DNA repair, transcriptional regulation, and protein localization.</p>

<p>FES antibody was raised in Mouse using a purified recombinant fragment of FES expressed in E. coli as the immunogen.</p>

<p>CDH23 antibody was raised in Rabbit using Human CDH23 as the immunogen</p>

Rabbit polyclonal PBXIP1 antibody

<p>The GILT antibody is a cytotoxic monoclonal antibody that specifically targets amyloid plaque protein dimers. It is widely used in Life Sciences research to study the formation and accumulation of amyloid plaques, which are associated with various neurodegenerative diseases such as Alzheimer's disease. This monoclonal antibody has high specificity and affinity for amyloid plaque protein dimers, making it an excellent tool for detecting and quantifying these abnormal protein aggregates. Additionally, the GILT antibody has been shown to have inhibitory effects on the growth factor signaling pathway, making it a potential therapeutic candidate for diseases characterized by excessive cell proliferation. With its exceptional quality and reliability, this antibody is a valuable asset for researchers investigating amyloid-related disorders.</p>

CFHR3 antibody was raised in Rabbit using Human CFHR3 as the immunogen

<p>Affinity purified Rabbit polyclonal AHI1 antibody</p>

LCK antibody was raised in Mouse using a purified recombinant fragment of human Lck expressed in E. coli as the immunogen.

<p>Rabbit polyclonal NMDAR1 antibody (Ser897)</p>

<p>Purified Polyclonal NEMF antibody</p>

<p>KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK</p>

Rabbit polyclonal NFKP p105/p50 antibody (Ser893)

<p>MRPS6 antibody was raised using the middle region of MRPS6 corresponding to a region with amino acids VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK</p>

<p>IL8 antibody was raised in rabbit using highly pure recombinant human IL-8 as the immunogen.</p>

Rabbit polyclonal CCL5 antibody (FITC)

The HER3 antibody is a phosphatase that belongs to the class of antibodies. It is a monoclonal antibody that specifically targets HER3, a receptor protein that plays a crucial role in cell growth and survival. This antibody has been shown to inhibit the interaction between HER3 and its ligand, preventing the activation of downstream signaling pathways involved in cancer progression.

DGKQ antibody was raised in Rabbit using Human DGKQ as the immunogen

<p>STX11 antibody was raised in rabbit using the C terminal of STX11 as the immunogen</p>

Streptococcus pneumoniae antibody (FITC) was raised in rabbit using a whole cell blend of numerous serotypes as the immunogen.

<p>Rabbit polyclonal NUP160 antibody</p>

The RIN1 antibody is a polyclonal antibody that targets the RIN1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion and signaling. The RIN1 antibody specifically binds to the RIN1 protein, inhibiting its activity and preventing it from interacting with other proteins in the cell. This antibody has been shown to have neutralizing effects on the RIN1 protein, making it a valuable tool for researchers studying its function and potential therapeutic applications. The RIN1 antibody is widely used in life sciences research, particularly in studies involving alpha-fetoprotein, E-cadherin, colony-stimulating factors, interferons, and autoantibodies such as antiphospholipid antibodies. Its high specificity and affinity make it an excellent choice for various experimental techniques, including immunohistochemistry, Western blotting, and ELISA assays. With its exceptional performance and reliable results, the RIN1 antibody is an indispensable tool for

<p>ANO1 antibody was raised in Rabbit using Human ANO1 as the immunogen</p>