Primary Antibodies

<p>HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It effectively treats tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The Keratin 18 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic and neutralizing properties. It is commonly used in Life Sciences research to study the role of keratin 18 in various cellular processes. This antibody specifically targets keratin 18, a type of intermediate filament protein found in epithelial cells.</p>

<p>GABA A Receptor alpha-1 antibody was raised in mouse using purified GABA/benzodiazepine receptor from bovine cortex as the immunogen.</p>

Purified Polyclonal MED22 antibody

Mouse monoclonal DCXR antibody

<p>The SOX5 antibody is a monoclonal antibody that targets the catechol-O-methyltransferase (COMT) enzyme. It is widely used in Life Sciences research as a biomolecule for various applications. This antibody specifically recognizes and binds to the activated form of COMT, inhibiting its enzymatic activity. By neutralizing COMT, the SOX5 antibody modulates dopamine levels, which plays a crucial role in several physiological processes.</p>

COPS7A antibody was raised using a synthetic peptide corresponding to a region with amino acids NLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGL

<p>The TUBA1C antibody is a growth factor that has been extensively studied in the field of Life Sciences. It has shown promising results as a potential multidrug and interferon therapy. This antibody has demonstrated the ability to inhibit the effects of ketamine and vasoactive intestinal peptide, both of which are involved in various physiological processes. Additionally, it has been found to have neutralizing properties against epidermal growth factor and collagen, making it a valuable tool in research and therapeutic applications. The TUBA1C antibody is available as a high-quality monoclonal antibody that has been tested for its efficacy and specificity. It can be used in various experimental techniques, including low-molecular-weight electrode assays and immunohistochemistry. Researchers and scientists can rely on this antibody to provide accurate and reliable results in their studies.</p>

<p>Rabbit polyclonal UMOD antibody</p>

Lymphotoxin alpha antibody is a highly specialized medicament used in Life Sciences research. It is an inhibitor that targets adeno-associated virus and plays a crucial role in pluripotent stem cells. This antibody has been extensively used in assays to study the effects of test compounds on interleukin production. Lymphotoxin alpha antibody possesses high affinity for its ligands and has been employed in the isolation of autoantibodies and extracellular markers. Its unique properties make it an indispensable tool for researchers studying various biological processes, including those related to the retina.

Rabbit polyclonal AEG1 antibody

<p>ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE</p>

<p>Mouse monoclonal LDH Pan antibody</p>

<p>MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM</p>

<p>Rabbit polyclonal CPN1 antibody</p>

<p>Rabbit polyclonal SMTNL2 antibody</p>

Mouse monoclonal GBP5 antibody

<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) in human serum. It can be used in various applications, including research in Life Sciences and diagnostics. This antibody binds to AFP, a glycoprotein that is normally produced by the liver during fetal development but can also be present in certain types of cancer, such as hepatocellular carcinoma and germ cell tumors.</p>

<p>The CD29 antibody is a highly effective monoclonal antibody that has multiple applications in the field of biotechnology. It can be used as a growth factor, a cdk4/6 inhibitor, and an antiviral agent. The CD29 antibody contains excipients such as globulin, which enhance its stability and efficacy. This powerful antibody has neutralizing properties and can effectively target molecules involved in various biological processes.</p>

Mouse anti human IgE (HRP) was raised in mouse using human IgE as the immunogen.

<p>Rabbit polyclonal GSK3 alpha/beta antibody</p>

Mouse monoclonal N-acetyltransferase antibody

<p>LSM14A antibody was raised using a synthetic peptide corresponding to a region with amino acids TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP</p>

<p>The Trx antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the growth hormone receptor, allowing for accurate detection and analysis of this important protein. The Trx antibody has been extensively tested and validated for its effectiveness in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). With its high affinity and specificity, the Trx antibody provides reliable and reproducible results in detecting growth hormone receptor expression in human serum samples. Additionally, this antibody has been shown to be effective in identifying autoantibodies and chemokines involved in interferon signaling pathways. Its unique characteristics make the Trx antibody an essential tool for researchers investigating the role of growth hormone receptor activation in various biological processes.</p>

The CTNNB1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and is produced using a lyophilization method for enhanced stability and longevity. This Monoclonal Antibody targets the CTNNB1 protein, also known as beta-catenin, which plays a crucial role in cell adhesion and signaling pathways.

<p>Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKE-A6 cells) as the immunogen.</p>

The XPA antibody is a polyclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the XPA protein, which plays a crucial role in DNA repair. This antibody is commonly used in studies involving mesenchymal stem cells, as well as in investigations related to thrombocytopenia and growth factors. The XPA antibody can also be utilized for the detection and quantification of various chemokines, antibodies, inhibitors, collagens, and other proteins of interest. Its high specificity and affinity make it an invaluable tool for researchers looking to understand the molecular mechanisms underlying different biological processes. With its colloidal properties and ability to bind to specific epitopes, this monoclonal antibody offers accurate and reliable results. Additionally, its low viscosity allows for easy handling and efficient use in various experimental protocols.

The MYC antibody is a monoclonal antibody that specifically targets the c-myc protein. This protein plays a crucial role in cell growth and proliferation, as well as in the regulation of genes involved in various cellular processes. The MYC antibody acts as an inhibitory factor, preventing the binding of c-myc to its target genes and thereby suppressing their expression.

<p>TSHR antibody was raised using the C terminal of TSHR corresponding to a region with amino acids KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS</p>

Rabbit polyclonal RPL17 antibody

STAT3 antibody was raised in Mouse using a purified recombinant fragment of human STAT3 expressed in E. coli as the immunogen.

<p>LY96 antibody was raised in Rabbit using Human LY96 as the immunogen</p>

<p>Rabbit polyclonal NSF antibody (biotin)</p>

Rabbit polyclonal NK4R antibody

The RANK antibody is a monoclonal antibody that specifically targets the receptor activator of nuclear factor kappa-B (RANK). It has been extensively studied for its role in regulating bone remodeling and immune cell activation. The RANK antibody binds to RANK, preventing its interaction with its ligand, RANKL. This inhibits the activation of osteoclasts, which are responsible for bone resorption, and reduces the production of pro-inflammatory cytokines by immune cells. Additionally, the RANK antibody has been shown to have therapeutic potential in treating conditions such as osteoporosis, rheumatoid arthritis, and certain types of cancer. Its high specificity and affinity make it a valuable tool for researchers in the life sciences field.

Mouse monoclonal IFIT1 antibody

<p>Rat monoclonal CD105 antibody (biotin)</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

Rabbit polyclonal SCAMP3 antibody (HRP)

<p>HIV1 p24 antibody was raised in mouse using HIV1 p24 (native antigen) as the immunogen.</p>

The CD146 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to CD146, a protein expressed on the surface of various cell types. This antibody has been extensively studied and proven to be effective in numerous applications.

<p>Mouse monoclonal CAMLG antibody</p>

EIF2S1 antibody was raised in mouse using recombinant Human Eukaryotic Translation Initiation Factor 2, Subunit 1 Alpha, 35Kda

<p>Rabbit polyclonal COMMD4 antibody (FITC)</p>

The CD325 antibody is a monoclonal antibody that is synthesized chemically. It belongs to the group of antibodies known as autoantibodies and has neutralizing properties. This antibody specifically targets insulin, a hormone that regulates blood sugar levels. CD325 antibody can be used for various applications in the field of life sciences, including insulin detection in human serum and research related to hyperinsulinaemic hypoglycaemia. It has been shown to have high specificity and sensitivity in recognizing insulin molecules and can be used in assays to measure insulin levels accurately. The CD325 antibody is a valuable tool for researchers studying the role of insulin in various physiological processes and diseases. Its unique properties make it an essential component in studies involving insulin and related molecules.

<p>The IL4 antibody is a low-molecular-weight monoclonal antibody used in Life Sciences. It is designed to neutralize the effects of Interleukin 4 (IL-4), a cytokine that plays a crucial role in immune responses. By binding to IL-4, this antibody prevents its interaction with its receptors, thereby inhibiting downstream signaling pathways.</p>

GSTM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF

<p>Rabbit polyclonal UBL3 antibody</p>

<p>Rat monoclonal CD16/32 antibody (allophycocyanin)</p>

Mouse monoclonal PYCR2 antibody

<p>Akt, also known as Protein Kinase B (PKB), is an essential cellular protein that governs vital processes such as cell growth, survival, metabolism, and proliferation through the PI3K/Akt pathway, which is activated by hormones like insulin. Upon activation, Akt translocates to the cell membrane, where it undergoes full activation via phosphorylation by kinases like PDK1. This activation allows Akt to prevent apoptosis, promote cell growth via pathways like mTOR, and boost glucose metabolism, crucial for insulin responsiveness. Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT</p>

Rabbit polyclonal RECQL5 antibody

<p>Rabbit polyclonal RIN3 antibody</p>

<p>CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC</p>

<p>Purified Rabbit polyclonal OR1B1 antibody</p>

The LLO antibody is a high-quality monoclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize superoxide, a highly reactive oxygen species that can cause damage to cells and tissues. This antibody has a high specific activity and exhibits low density, making it an ideal choice for various applications such as enzyme-linked immunosorbent assays (ELISA), Western blotting, and immunohistochemistry.

<p>Purified Rabbit polyclonal PKA antibody (Thr197)</p>

<p>Rabbit polyclonal MYD1 antibody</p>

<p>Rabbit polyclonal TRERF1 antibody</p>

<p>Rabbit polyclonal ELMOD2 antibody</p>

<p>Rabbit polyclonal RTKN2 antibody</p>

<p>The CEA antibody is a highly specialized monoclonal antibody that targets carcinoembryonic antigen (CEA). It is widely used in the field of life sciences for various applications. This antibody specifically recognizes and binds to CEA, a glycosylated protein that is involved in cell adhesion and plays a role in insulin signaling.</p>

LDLRAP1 antibody was raised using the N terminal of LDLRAP1 corresponding to a region with amino acids WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK

Tollip antibody was raised in mouse using recombinant human Tollip (61-274aa) purified from E. coli as the immunogen.

<p>LASP1 antibody was raised using the middle region of LASP1 corresponding to a region with amino acids IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This drug is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. It works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH</p>

<p>Mouse monoclonal Amyloid Beta A4 Precursor antibody</p>

<p>DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW</p>

<p>Purified Polyclonal CYP4Z1 antibody</p>

<p>Purified Rabbit polyclonal HMG17 antibody</p>

<p>Rabbit polyclonal Osteopontin antibody (FITC)</p>

Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.

<p>GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ</p>

Mouse monoclonal SH2D2A antibody

<p>KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ</p>

ANKRD11 antibody was raised in mouse using recombinant Human Ankyrin Repeat Domain 11 (Ankrd11)

<p>RDX antibody was raised using the middle region of RDX corresponding to a region with amino acids MSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVT</p>

The XRCC5 antibody is a polyclonal antibody that specifically targets XRCC5, also known as Ku80. XRCC5 is a glycoprotein that plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is commonly used in life sciences research to study the function and localization of XRCC5 in various cellular processes.

The NSE antibody is a powerful tool in the field of life sciences. It is an interferon that exhibits cytotoxic properties and specifically targets transthyretin. This antibody binds to transthyretin, a protein that plays a crucial role in various biological processes. By binding to transthyretin, the NSE antibody can modulate its activity and function.

<p>SEC5 antibody is a highly versatile growth factor that plays a crucial role in various biological processes. This globulin is widely used in Life Sciences research as both polyclonal and monoclonal antibodies. SEC5 antibody has been shown to interact with aldo-keto reductase, an enzyme involved in the metabolism of various compounds. It also acts as an inhibitory factor against certain antiviral activities, making it a valuable tool in virology research. Additionally, SEC5 antibody has been found to modulate the expression of E-cadherin, a protein involved in cell adhesion and migration. With its wide range of applications and excellent specificity, SEC5 antibody is an essential component for any researcher working in the fields of interferon, chemokine, or colony-stimulating factor research.</p>

CYP11A1 antibody was raised using the N terminal of CYP11A1 corresponding to a region with amino acids QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL

<p>The S1PR1 antibody is a monoclonal antibody that targets the S1P receptor 1, a cell surface receptor involved in various cellular processes such as growth factor signaling and chemokine-induced migration. This antibody specifically recognizes and binds to the S1P receptor 1, blocking its activation and downstream signaling pathways. It has been extensively used in Life Sciences research to study the role of S1P receptor 1 in different biological processes.</p>

JMJD2A antibody was raised in mouse using recombinant Omo Sapiens Jumonji Domain Containing 2A

CIB1 antibody was raised in mouse using recombinant human CIB1 (1-191aa) purified from E. coli as the immunogen.

IDS antibody is an intraocular antibody that plays a crucial role in the immune response. This monoclonal antibody specifically targets and neutralizes adeno-associated virus (AAV), which is commonly associated with various ocular diseases. IDS antibody works by binding to the viral antigens, preventing them from infecting host cells and causing damage. Additionally, this antibody has been shown to have antiviral properties, inhibiting the replication of AAV and reducing viral load. IDS antibody is a promising therapeutic option for individuals suffering from ocular conditions caused by AAV infections. Its specificity and ability to neutralize the virus make it a valuable tool in the field of life sciences and ophthalmology research.

<p>RNF169 antibody was raised using the N terminal of RNF169 corresponding to a region with amino acids DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR</p>

<p>The GPR151 antibody is a monoclonal antibody that specifically targets the human mitochondrial protein GPR151. This protein is involved in various cellular processes, including epidermal growth factor signaling and regulation of cell proliferation. The GPR151 antibody can be used in Life Sciences research, particularly in the study of mitochondrial function and signaling pathways.</p>

<p>Mouse monoclonal MIF4GD antibody</p>

<p>Rabbit polyclonal PLCG1 antibody (Tyr783)</p>

<p>The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.</p>

<p>Purified Rabbit polyclonal DNAJB11 antibody</p>

<p>Purified Polyclonal QSER1 antibody</p>

Mouse monoclonal VGlut2 Transporter

<p>Mouse monoclonal DFFA antibody</p>

<p>Cytokeratin 7 antibody is a highly specific monoclonal antibody that targets the protein complex of cytokeratin 7. It is commonly used in Life Sciences research to study various cellular processes and functions. This antibody has been shown to have high affinity for cytokeratin 7, making it a valuable tool for detecting and quantifying this protein in different biological samples.</p>

Rabbit polyclonal SEPSECS antibody

The DHFR antibody is a monoclonal antibody that is used in Life Sciences research. It is commonly used to detect and study antiphospholipid antibodies, which are associated with various autoimmune disorders such as heparin-induced thrombocytopenia. The DHFR antibody can also be used to investigate the role of interferon and caffeine in cellular processes.