Primary Antibodies

<p>CRABP2 antibody was raised in mouse using recombinant human CRABP2 (1-138aa) purified from E. coli as the immunogen.</p>

Rabbit polyclonal VPS53 antibody

<p>Rabbit Polyclonal OR7A10 antibody</p>

The NANP antibody is a monoclonal antibody that specifically targets the catechol-o-methyltransferase (COMT) enzyme. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. The NANP antibody binds to COMT and inhibits its activity, leading to increased levels of vasoactive intestinal peptide (VIP). VIP is an important regulatory peptide involved in various physiological processes, including immune response modulation and cell survival.

PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.

<p>Rabbit polyclonal RAB3B antibody</p>

<p>Rabbit polyclonal PVRL3 antibody</p>

The RIN1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It belongs to the family of antibodies known as polyclonal antibodies, which are capable of recognizing and binding to multiple targets. This particular antibody has been extensively studied in the field of life sciences and has shown remarkable potential in various applications.

<p>Rabbit polyclonal PLCB2 antibody</p>

STEAP1 antibody was raised in mouse using recombinant human STEAP1 (1-70aa) purified from E. coli as the immunogen.

<p>The CBL antibody is a highly specialized antibody used in the field of life sciences. It is a polyclonal antibody that targets dopamine and progesterone, among other molecules. This antibody has the unique ability to neutralize these substances, making it an essential tool for research and experimentation. The CBL antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting. Its high specificity and sensitivity ensure accurate and reliable results. Whether you are studying activated adipose cells or investigating the role of chemokines in disease progression, the CBL antibody is an indispensable tool in your research arsenal. Order yours today and unlock new insights in your scientific endeavors.</p>

CCNF antibody was raised in mouse using recombinant Human Cyclin F (Ccnf)

<p>LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV</p>

Mouse monoclonal ELK3 antibody

<p>RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL</p>

<p>Rabbit polyclonal TOM70 antibody</p>

The HSP25 antibody is a monoclonal antibody that specifically targets the antigen HSP25. This antibody is widely used in the field of life sciences for various applications, including research and diagnostics. The HSP25 antibody can be used to detect and quantify the levels of HSP25 in different samples, such as human serum or cell lysates. It can also be used in immunohistochemistry and immunofluorescence experiments to visualize the localization of HSP25 within cells or tissues. Additionally, this antibody has been utilized in studies investigating the role of HSP25 in various biological processes, such as its interaction with TGF-beta signaling pathways or its involvement in helicobacter infections. With its high specificity and sensitivity, the HSP25 antibody is an essential tool for researchers studying protein-protein interactions or exploring potential therapeutic targets.

<p>Rabbit polyclonal THBS3 antibody</p>

<p>Horse RBC antibody (Texas Red) was raised in rabbit using equine erythrocytes as the immunogen.</p>

TUBD1 antibody was raised in mouse using recombinant Human Tubulin, Delta 1 (Tubd1)

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target tuberculosis infection and contains active compounds known for their potent bactericidal activity. The key mechanism of action involves binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes, confirming its high efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also exhibits specific binding to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal LENG1 antibody</p>

<p>The STAT1 antibody is a monoclonal antibody that specifically targets the STAT1 protein. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and immune response. The STAT1 antibody binds to the STAT1 protein, preventing its activation and subsequent signaling cascade. This inhibition can have significant effects on cell function and can be used in various research applications in the life sciences field. Whether you are studying cell signaling pathways or investigating the role of STAT1 in disease development, this monoclonal antibody is an invaluable tool. With its high specificity and affinity for the target protein, the STAT1 antibody ensures accurate and reliable results in your experiments. Trust this antibody to provide you with the precise data you need for your research endeavors.</p>

<p>The CTNNB1 antibody is a cytotoxic monoclonal antibody that targets the CTNNB1 protein. This protein plays a crucial role in cell signaling pathways and is involved in various cellular processes, including cell growth, differentiation, and apoptosis.</p>

<p>The PAR1 antibody is a highly specialized immunohistochemistry tool used in Life Sciences research. It is an adeno-associated virus (AAV)-based vector that delivers specific antibodies to target cells. The PAR1 antibody specifically targets the protease-activated receptor 1 (PAR1) and inhibits its activation by blocking the binding of thrombin, the main activator of PAR1. This monoclonal antibody is designed to neutralize PAR1 activity and has been proven effective in various studies.</p>

<p>Rabbit polyclonal SEPARASE antibody (Ser801)</p>

<p>Rabbit polyclonal SNRPD3 antibody</p>

<p>ACTRT2 antibody was raised using the C terminal of ACTRT2 corresponding to a region with amino acids LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT</p>

<p>The SUOX antibody is a monoclonal antibody that has various characteristics and applications. It is primarily used as a diuretic and immunosuppressant in the field of medicine. This antibody targets adipose tissue and inhibits the activity of 3-kinase, which plays a role in fat metabolism. By doing so, it promotes weight loss and helps regulate body composition.</p>

Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF

<p>IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE</p>

Rat monoclonal IgM antibody (PE)

The ACAT1 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It targets and interacts with the acetyltransferase enzyme, which plays a crucial role in various cellular processes. This antibody has been shown to have significant effects on insulin signaling pathways and β-catenin regulation.

Mouse monoclonal OSBPL11 antibody

<p>RPS13 antibody was raised using the middle region of RPS13 corresponding to a region with amino acids ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES</p>

<p>The CTNNB1 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the CTNNB1 protein, also known as beta-catenin, which plays a crucial role in cell adhesion and signaling pathways. This antibody is produced using advanced techniques and has been extensively validated for its specificity and sensitivity.</p>

<p>Purified Rabbit polyclonal ADRB2 antibody (Ser346)</p>

<p>KI67 antibody was raised in rabbit using synthetic peptide derived from human Ki-67 protein as the immunogen.</p>

<p>Rabbit polyclonal p57 Kip2 antibody (Thr310)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Rabbit polyclonal TNPO1 antibody</p>

<p>Rabbit polyclonal SLC25A2 antibody</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

Purified Polyclonal MAST4 antibody

<p>The Moesin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying growth factors, binding proteins, and various cellular processes. This antibody is widely used in electrode-based experiments to study the interaction between specific proteins and their targets. Additionally, it has been utilized to investigate the role of Moesin in androgen signaling pathways. The Moesin antibody is also employed in the detection of autoantibodies present in human serum samples. With its high specificity and sensitivity, this antibody is an essential tool for researchers working on protein analysis and understanding complex cellular mechanisms.</p>

<p>Rabbit polyclonal CEB beta antibody</p>

<p>Rabbit polyclonal RAB41 antibody</p>

<p>LOC285033 antibody was raised using the N terminal of LOC285033 corresponding to a region with amino acids VIKEGAVCGIARPKTSRVNSSQDQIQVASENTHSGSLHQRPASGARLPAS</p>

Mouse monoclonal TBCB antibody

The SOX2 antibody is a nuclear antibody that is commonly found in human serum. It is often used in research related to interferon-gamma (IFN-gamma) and other aspects of the immune system. This monoclonal antibody specifically targets the SOX2 protein, which plays a crucial role in various cellular processes. It has been shown to interact with actin filaments, leading to changes in cell morphology and function. Additionally, this antibody has cytotoxic properties and can be used to selectively target and destroy activated cells. With its high specificity and effectiveness, the SOX2 antibody is widely used in life sciences research and holds great potential for therapeutic applications.

Mouse monoclonal CNDP1 antibody

<p>Purified Polyclonal TCEB3C antibody</p>

The SP1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of anti-CD20 antibodies and is used for various research purposes. This antibody specifically targets and binds to the CD20 protein, which is expressed on the surface of certain cells, including B lymphocytes.

<p>The PD1 antibody is a monoclonal antibody that has been developed as a pneumococcal vaccine. It works by targeting and binding to the PD1 receptor on immune cells, which helps to enhance the body's immune response against pneumococcal infections. In addition to its role in immunity, the PD1 antibody also has other potential applications in the field of life sciences.</p>

Rabbit polyclonal GBP4 antibody

<p>Purified Polyclonal MYBPC2 antibody</p>

Rat monoclonal CD44 antibody (PE)

<p>Mouse monoclonal PDE1B antibody</p>

Morphine antibody was raised in mouse using morphine-BSA as the immunogen.

The CD25 antibody is a cytotoxic monoclonal antibody that specifically targets activated T cells expressing the CD25 antigen. It is commonly used in immunoassays and research in the field of Life Sciences. This antibody can be conjugated to colloidal gold or other markers for detection purposes. The CD25 antibody has been shown to neutralize the activity of interleukin-17A (IL-17A), a cytokine involved in inflammation and autoimmune diseases. It works by binding to the IL-17A receptor on target cells, preventing IL-17A from exerting its effects. The CD25 antibody can also be used as a therapeutic drug for conditions where excessive activation of T cells is undesirable. Its phosphatase activity allows it to modulate T cell signaling pathways, leading to suppression of immune responses. With its high specificity and affinity, this monoclonal antibody offers great potential for targeted therapies and diagnostic applications in various fields of research.

<p>Mouse monoclonal TPMT antibody</p>

<p>The GOLM1 antibody is a highly effective nanocomposite that targets actin filaments in the body. This monoclonal antibody has been specifically designed to neutralize the activity of TGF-beta, a protein that plays a crucial role in cell growth and differentiation. By blocking TGF-beta, the GOLM1 antibody inhibits the formation of collagen and other extracellular matrix proteins, thereby preventing tissue fibrosis and promoting tissue repair. This antibody can be used in various life science applications, including research studies and diagnostic assays. With its high specificity and potency, the GOLM1 antibody is an invaluable tool for scientists and researchers working in the field of cell biology.</p>

<p>The HSP90 antibody is a highly specific monoclonal antibody that targets the heat shock protein 90 (HSP90). This protein plays a crucial role in cellular processes such as protein folding, cell signaling, and stress response. The HSP90 antibody can be used for various applications in Life Sciences research, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>The TIMP3 antibody is a polyclonal antibody that specifically targets TGF-beta. It is widely used in life sciences research to study the role of TGF-beta in various biological processes. This antibody has been shown to inhibit the activity of pancreatic elastase, an enzyme involved in tissue destruction. Additionally, it has been found to interfere with glycosylation, a process essential for proper protein function. The TIMP3 antibody can also block the activity of growth factors and lectins, further highlighting its versatility in research applications. With its cytotoxic properties, this antibody holds promise as a potential medicament for various diseases. It has demonstrated efficacy in targeting human serum and inhibiting the activity of VEGF, a key factor involved in angiogenesis. Overall, the TIMP3 antibody offers researchers a valuable tool for studying TGF-beta-related processes and developing novel therapeutic strategies.</p>

Leptin antibody was raised in mouse using highly pure recombinant human leptin as the immunogen.

LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

<p>IL33 antibody was raised using the N terminal of IL33 corresponding to a region with amino acids AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC</p>

<p>Rabbit polyclonal ILF3 antibody</p>

Mouse monoclonal ZFAND2B antibody

<p>FAM79B antibody was raised using the N terminal Of Fam79B corresponding to a region with amino acids DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH</p>

The Ofloxacin monoclonal antibody is a powerful tool in the field of Life Sciences. It has the unique ability to neutralize interferon, a key player in the immune response. This antibody specifically targets and binds to ofloxacin, a widely used antibiotic, preventing its action on bacteria.

Mouse monoclonal LDHB antibody

<p>The RAB3D antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the alpha-fetoprotein (AFP) in human serum. Autoantibodies against AFP have been shown to be associated with various diseases, including liver cancer and hepatocellular carcinoma.</p>

<p>Rabbit polyclonal AurB antibody (Thr232)</p>

<p>The VAV1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target specific antigens, such as tissue transglutaminase and brain natriuretic peptide, in human serum. This monoclonal antibody has been extensively tested and proven to have high affinity and specificity for its target antigens.</p>

<p>Rabbit polyclonal OR13C3 antibody</p>

<p>Mouse Monoclonal KRT20 antibody</p>

<p>PSMD8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

hCG beta antibody (HRP) was raised in mouse using hCG beta as the immunogen.

<p>Rabbit polyclonal SPG20 antibody</p>

LDLRAP1 antibody was raised using the N terminal of LDLRAP1 corresponding to a region with amino acids WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK

Tollip antibody was raised in mouse using recombinant human Tollip (61-274aa) purified from E. coli as the immunogen.

<p>LASP1 antibody was raised using the middle region of LASP1 corresponding to a region with amino acids IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This drug is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. It works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH</p>

<p>Mouse monoclonal Amyloid Beta A4 Precursor antibody</p>

<p>DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW</p>

<p>Purified Polyclonal CYP4Z1 antibody</p>

<p>Purified Rabbit polyclonal HMG17 antibody</p>

<p>Rabbit polyclonal Osteopontin antibody (FITC)</p>

Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.

<p>GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ</p>

Mouse monoclonal SH2D2A antibody

<p>KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ</p>

ANKRD11 antibody was raised in mouse using recombinant Human Ankyrin Repeat Domain 11 (Ankrd11)

<p>RDX antibody was raised using the middle region of RDX corresponding to a region with amino acids MSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVT</p>

The XRCC5 antibody is a polyclonal antibody that specifically targets XRCC5, also known as Ku80. XRCC5 is a glycoprotein that plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is commonly used in life sciences research to study the function and localization of XRCC5 in various cellular processes.

The NSE antibody is a powerful tool in the field of life sciences. It is an interferon that exhibits cytotoxic properties and specifically targets transthyretin. This antibody binds to transthyretin, a protein that plays a crucial role in various biological processes. By binding to transthyretin, the NSE antibody can modulate its activity and function.